Using multimaping reads or unique reads on featurecounts?
Using multimaping reads or unique reads on featurecounts? 0 I’m working with Rat transcriptome (mRNA) using HISAT as aligner and featurecounts (subread) to count reads using BAM files from HISAT. Featurecounts has the possibility to count only unique reads or multi-mapping reads. What is the best practice, taking into account…
A Practical Introduction (May 3-5, 2023 in Munich, Germany)
News:Next-Generation Sequencing Data Analysis: A Practical Introduction (May 3-5, 2023 in Munich, Germany) 0 📣Attention all biologists! 🧬 Are you interested in expanding your knowledge in Next-Generation Sequencing (NGS) and bioinformatics? 🧐 Look no further! We are excited to announce our upcoming hands-on workshop on NGS Data Analysis from May…
How to import impute2.dosage files to analyse it in R (GWAS)
How to import impute2.dosage files to analyse it in R (GWAS) 0 Hello all. I want to do a Poisson regression, I have a dataset of 1800 people with 9m SNPs each. First of all, I’m having some trouble importing the info of each SNP, I tried using “gawk” in…
1000 genomes hg38 with dbSNP rsid
1000 genomes hg38 with dbSNP rsid 1 Hi, Anyone know where I can download the latest version of 1000 Genomes, on build hg38, in VCF format (or PLINK format), that ALSO contains the dbSNP RSid in the VCF ID field? I looked at the IGSR website, dbSNP, UCSC, etc. So…
Michigan Imputation server failed job
Michigan Imputation server failed job 0 This is the first time I use Michigan Imputation Server. My imputation worked as it should on all chromosomes (1 to 22) apart from chromosome 9, where the job starts and then it fails and I don’t know why and how to fix this…
MD simulation error
MD simulation error 0 Hello! I am trying to run MD simulation on schrodinger 2020-1 but it gives me the following error : 31 force/energy overflows detected. @src/mdlib/force_accumulator/gpu_check_forces.cu:63 in (unknown) Any idea what it might be? MD schrodinger • 29 views Login before adding your answer. Read more here: Source…
File has zero value indivuals
File has zero value indivuals 0 Dear all, I have vcf file, I extracted the chromosome from it with vcftools and used in plink for haploview out vcftools –vcf chr10.vcf –plink –out Chr10.vcf tab indexing, plink I am getting the error “File has zero value indivuals” when uploading .ped and…
Kallisto bustools for scRNA-seq
Kallisto bustools for scRNA-seq 0 Hi, I followed several tutorials about single cell rna-seq analysis for paired end. However, I need to quantify single ends scRNA-seq dataset. I have used for paired ends. Does anyone know how to use kallisto scrna-seq for single ends? I am open to other suggestions….
KEGGList Error in R
KEGGList Error in R 0 Hi, I’m working with pathfinder and I’m setting the KEGG pathway about rattus norvegicus, but… When I search for pathways or anything else for my reference specie, I get this error: pathways.list <- keggList(“pathway”, “rno”) Error in curl::curl_fetch_memory(url, handle = handle):Failure when receiving data from…
Discordinant aligment
Discordinant aligment 0 hi my result of hisat2 alignment is : 23250959 reads; of these: 23250959 (100.00%) were paired; of these: 2462449 (10.59%) aligned concordantly 0 times 19974163 (85.91%) aligned concordantly exactly 1 time 814347 (3.50%) aligned concordantly >1 times —- 2462449 pairs aligned concordantly 0 times; of these: 1511718…
GATK VariantAnnotator -A PossibleDeNovo
GATK VariantAnnotator -A PossibleDeNovo 0 Hello everybody, I am using GATK VariantAnnotator -A PossibleDeNovo to find de novo mutations in the ASD family. However, there are some errors in my command lines and I don’t have the ability to handle them. Here are the command lines I use to find…
Mac program for DNA/RNA/protein gel/blot, cells/colonies image analysis
Tool:BioLabImage – Mac program for DNA/RNA/protein gel/blot, cells/colonies image analysis 0 BioLabImage is a tool for the analysis of DNA/RNA/protein gel/blot images as wells as cells/colonies images. The app provides automatic measurement of relative fold-change of the selected bands on the gel/blot images. The user can automatically count the bacteria/yeast…
OpenAI VS DeepMind – Social News Daily
After OpenAI launches ChatGPT in November 2022, almost all eyes of the world are drawn to this powerful AI Chatbot. The last time an AI product caused such a global sensation was precisely DeepMind’s AlphaGo, an AI robot that defeated the human Go champion in a row. This article will…
AI Develops Cancer Drug in 30 Days, Predicts Life Expectancy with 80% Accuracy
AI technologies invented by scientists at the University of British Columbia and B.C. Cancer has succeeded in discovering a previously-unknown treatment pathway for an aggressive form of liver cancer, designing a new drug to treat it in the process. The team also deployed AI to determine a patient’s life expectancy, by…
Cancer Treatment Developed in 30 Days With AI
Artificial Intelligence has developed a treatment for cancer in just 30 days. Researchers at the University of Toronto, along with Insilico Medicine, used an AI drug discovery platform called Pharma.AI to create a potential treatment for hepatocellular carcinoma (HCC), the most common type of primary liver cancer. According to the…
In just 30 days, artificial intelligence devises cancer cure.
Artificial intelligence has developed a cure for an aggressive form of cancer in just 30 days and has shown that it can predict patient survival using doctors’ records. The hacks were implemented through separate systems, but they show how the use of powerful technology goes beyond the creation of images…
AI develops liver cancer treatment in 30 days
21 March 2023 Artificial intelligence has developed a cancer treatment in 30 days. AI has developed a treatment for liver cancer In a new study, researchers at the University of Toronto worked with Insilico Medicine to develop a potential treatment for hepatocellular carcinoma (HCC) – an aggressive form of liver…
Artificial Intelligence Can Cure Liver Cancer in 30 Days
Researchers at the University of Toronto, along with Insilico Medicine, have developed a potential treatment for hepatocellular carcinoma (HCC) using an artificial intelligence (AI) drug discovery platform called Pharma.AI. HCC is the most common type of liver cancer and occurs when a tumor grows on the liver. The researchers applied…
Scientists at DeepMind and Meta Press Fusion of AI, Biology
Meta Platforms Inc.’s new tool predicting the structure of hundreds of millions of proteins is the latest example of a breakthrough in computational biology that began several years ago at an Alphabet Inc. subsidiary. Some scientists expect the new class of artificial-intelligence systems to accelerate work in the life sciences,…
Installing rlang version 1.1.0
I was trying to install ExomeDepth pacakge, after that one of its command from its document getBamCounts gives following error. Error in loadNamespace(i, c(lib.loc, .libPaths()), versionCheck = vI[[i]]) : namespace ‘rlang’ 1.0.5 is already loaded, but >= 1.1.0 is required Error in loadNamespace(i, c(lib.loc, .libPaths()), versionCheck = vI[[i]]): namespace ‘rlang’…
NVIDIA Unveils Large Language Models and Generative AI Service to Advance Life Sciences R&D
Part of NVIDIA AI Foundations, New BioNeMo Cloud Service Accelerates Life Sciences Research, Drug Discovery and Protein Engineering; Amgen and a Dozen Startups Among Early Access Customers GTC—NVIDIA today announced an expanded set of generative AI cloud services for customizing AI foundation models to accelerate the creation of new proteins…
AI Finds Potential Liver Cancer Treatment In Just 30 Days, Predicts Survival Rate
Claiming that artificial intelligence can do it all might sound far-fetched at the moment, but with the right training, AI tools could unlock answers in avenues that have plagued humanity for the longest time, including disease management and prevention. An artificial intelligence tool was able to develop a treatment for…
How to get a list of genes information for a pathway?
How to get a list of genes information for a pathway? 0 I am interested in several lists of gens for plant hormonal biosynthesis and signaling pathway (e.g. ABA biosynthesis) Where can I get this information? What publicly available websites besides KEGG? How to download list of genes information for…
Initial Genomic Analysis of BRCA Prospective
CPTAC3-BRCA-TP: WXS Copy number analysis (GISTIC2) CPTAC3-BRCA-TP: Mutation Significance Analysis (MutSig2CV) CPTAC3-BRCA-TP: Mutation Signature Analysis (SignatureAnalyzer) CPTAC3-BRCA-TP: Mutation Signature Analysis Reduced Hyper Mutant Effect (SignatureAnalyzer) CPTAC3-BRCA-noHyper: Mutation Significance Analysis (MutSig2CV) CPTAC3-BRCA-noHyper: Mutation Signature Analysis (SignatureAnalyzer) CPTAC3-BRCA-noHyper: Mutation Signature Analysis Reduced Hyper Mutant Effect (SignatureAnalyzer) CPTAC3-BRCA-BasalTNBC: WXS Copy number analysis (GISTIC2)…
New Arylazo-Based (Chromene-Thiazole) Hybrids as Potential MRSA Inhibitors
A three-component protocol was established to efficiently synthesize (chromene-thiazole) and related arylazo analogs in good to excellent yields. The desired products were prepared by reacting the appropriate salicylaldehydes, 2-cyanothioacetamide, and chloroacetone or hydrazonyl chlorides. Using piperidine as a mediator in ethanol at 80 °C for 4-6 h, the three-component protocol…
Technical Writer (DataSpell) – DataSpell
Technical Writer (DataSpell) DataSpell is a new JetBrains IDE for professional Data Scientists. DataSpell is geared towards exploratory data analysis and prototyping ML models and combines the interactivity of Jupyter notebooks with intelligent Python and R coding assistance. The ultimate goal is to make data science work more efficient and…
JetBrains dataSpell 2022.1.1 Full Version Download
Free Download JetBrains dataSpell full version standalone offline installer for Windows. This is an Integrated Development Environment (IDE) for Professional Data Scientists. Overview of JetBrains dataSpell This Integrated Development Environment (IDE) is dedicated to specific tasks for exploratory data analysis and prototyping ML (machine learning) models. You can switch between…
Evolutionary conservation of the fidelity of transcription
Multiple proteins are required to maintain the fidelity of transcription in yeast Using genetically engineered yeast strains21,36,37 and massively parallel sequencing technology34,35, we and others previously demonstrated that the non-essential subunits Rpb9 and TFIIS enhance the fidelity of transcription of RNAPII in living cells16,21,26,34,35,36,37,38,39. In addition, we showed that the…
Directing in-vitro Paraxial Mesodermal Differentiation of Human iPSCs and Guiding the Alignment of C2C12 Myoblast Differentiation using Photopatterning
Summary Skeletal muscle regeneration is highly impaired in patients suffering from skeletal muscle disorders like muscular dystrophies, volumetric muscle loss or sarcopenia. Clinically relevant in-vitro skeletal muscle models are needed to better understand these disorders and develop personalized therapeutic strategies. Closely mimicking the developmental myogenesis and the anisotropic organization of…
Frontrunners in the Latest Stem Cell Technology
TreeFrog Therapeutics is leaping ahead in cell therapies through resources such as new technologies and investor partnerships. For more than a decade, manufacturers have been exploring new ways to improve the efficiency of cell therapy production to make it more cost-effective and accessible to those in need. Many companies have…
Accelerating Cryptic Pocket Discovery Using AlphaFold
Cryptic pockets, or pockets absent in ligand-free, experimentally determined structures, hold great potential as drug targets. However, cryptic pocket openings are often beyond the reach of conventional biomolecular simulations because certain cryptic pocket openings involve slow motions. Here, we investigate whether AlphaFold can be used to accelerate cryptic pocket discovery…
Important step towards accurate use of stem c
During the past ten years, scientists have learned to create induced pluripotent stem cells (iPSC) from ordinary cells by genetic reprogramming. These cells are widely used to study diseases, as they can be differentiated to almost any cell type of the body, and they can be generated from any individual….
AI develops cancer treatment in 30 days, predicts survival rate
Artificial Intelligence has developed a treatment for cancer in just 30 days and can predict a patient’s survival rate. In a new study published in the journal Chemical Science, researchers at the University of Toronto along with Insilico Medicine developed a potential treatment for hepatocellular carcinoma (HCC) with an AI…
Scientists create mice from two dads after making eggs from skin cells
JAPAN — Scientists have created mice with two biologically male parents for the first time – a significant milestone in reproductive biology. The team, led by Katsuhiko Hayashi, a professor of genome biology at Osaka University in Japan, generated eggs from the skin cells of male mice that, when implanted…
Gengis Khan – iFunny
memepedia log in Animals & Nature Anime & Manga Art & Creative Cars Celebrities Gaming Girls Internet Memes Movies Other Politics Science & Tech Sports TV shows log in add meme new featured top memes memes catalog Animals & Nature Anime & Manga Art & Creative Cars Celebrities Gaming Girls…
AlphaFold predicts novel human proteins with knots
The fact that proteins can have their chain formed in a knot is known for almost 30 years. However, as they are not common, only a fraction of such proteins is available in the Protein Data Bank. It was not possible to assess their importance and versatility up until now…
Breast Cancer Liquid Biopsy Market Size By Manufacturers, Share, Growth, Trends, Types and Applications, Forecast to 2031
PRESS RELEASE Published March 24, 2023 The leading analysts and researchers at Reports and Insights compiled and outlined the assessment of the influence of recommendations on market operations and exercises. The research comprises data driven by the market’s historical and present circumstances, as well as other elements impacting the market’s…
BetaLife and A*STAR Agree to Focus on Novel Cell-Based Therapy for Diabetes
BetaLife agreed to collaborate with the Agency for Science, Technology and Research (A*STAR), both organizations based in Singapore, to accelerate the development of next generation cell-based therapy for diabetes. BetaLife, a stem cell therapy company focused on developing regenerative medicine for diabetes, has acquired the rights to human induced Pluripotent…
Innovent Announces Clinical Data of Multiple Trials Will be Presented at the AACR Annual Meeting 2023
ROCKVILLE, Md. and SUZHOU, China, March 21, 2023 /PRNewswire/ — Innovent Biologics, Inc. (“Innovent”) (HKEX: 01801), a world-class biopharmaceutical company that develops, manufactures and commercializes high-quality medicines for the treatment of oncology, autoimmune, metabolic, ophthalmology and other major diseases, today announced that clinical data from multiple trials in relation to…
Alonzo Demetrius Releases Soulful R&B Single “Runnin'”
Alonzo Demetrius, the rising star in the R&B scene, has released his latest single, “Runnin’,” featuring production from Ivan Jackson, Gengis Don, and Daniel Abraham. The track tells the story of a tumultuous “situations,” with Alonzo’s raw vocals and introspective lyrics capturing the emotions of someone who has had enough…
AI Revolutionizes Cancer Treatment with 30-Day Cure and Survival Rate Predictions
A groundbreaking study published in the journal Chemical Science reveals that artificial intelligence (AI) has successfully created a cancer treatment in merely 30 days while also predicting patient survival rates. Researchers from the University of Toronto and Insilico Medicine collaborated to develop a potential treatment for hepatocellular carcinoma (HCC), the…
Call for Application: Postdoc in Bioinformatics
Radboud university medical center is looking for an ambitious bioinformatician, who develops data analysis and integration approaches for large-scale -omics data and translates its outcome to biological insights. Within the Medical BioSciences deparment, the Bioinformatics Research Group led by Prof. Peter-Bram ‘t Hoen is well known for the development…
Industry Recent Developments and Technology, Size, Trends, Growth, and Forecast Research Report 2031
PRESS RELEASE Published March 24, 2023 Reports and Insights freshly added a report titled “Central Labs Market: Opportunity Analysis and Future Assessment 2023-2031” in its database of market research reports which offers its readers a detailed and profound analysis on the fresh growth opportunities, trends and growth drivers that are…
Scientists create mice from two males in major breakthrough
It’s pretty well known that usually two sexes have to be involved for reproduction, but a team of scientists in Japan might have just blown that assumption out of the water. Led by Katsuhiko Hayashi, a professor of genome biology at Osaka University in Japan, the team have been able…
TDAG51 Attenuates Impaired Lipid Metabolism and Insulin Resistance in Gestational Diabetes Mellitus Through SREBP-1/ANGPTL8 Pathway
Background: T-cell death-associated gene 51 (TDAG51) belongs to the transcription factor family and is involved in the energy homeostasis of the liver through the regulation of lipogenesis. Aims: To evaluate the role of T-cell death-associated gene 51 in gestational diabetes mellitus. Study design: Experimental study. Methods: A total of 30…
John M. Jumper – Wikipedia
From Wikipedia, the free encyclopedia John Michael Jumper is a senior research scientist at DeepMind Technologies.[4][5][6] Jumper and his colleagues created AlphaFold,[7] which uses artificial intelligence (AI) to predict protein structures from their amino acid sequence with high accuracy.[8] Jumper has stated that the AlphaFold team plans to release 100…
Postdoctoral researcher at ETH Zurich: microbiome bioinformatics and metagenomics
The Laboratory of Food Systems Biotechnology (FSB) at ETH Zurich, the Swiss Federal Institute of Technology, develops computational methods and utilizes “omics” technologies to study microbial ecosystems in food production and human health, with the ultimate goal of creating microbial communities and products that optimize food quality, safety, and human…
Genetic Risk of Substance Use Disorders Untangled in Large-Scale GWAS Meta-Analysis
NEW YORK – An international research consortium led by scientists at Washington University in St. Louis has uncovered genetic risk loci associated with many forms of addiction, including to alcohol, tobacco, opioids, and cannabis. The results, from a large-scale genome-wide association study meta-analysis that comprised more than 1.1 million individuals,…
Electrokinetic separation of cfDNA in insulator-based dielectrophoresis systems: a linear model of cfDNA and investigation of effective parameters
doi: 10.1088/1361-648X/ac6476. Affiliations Expand Affiliation 1 School of Mechanical Engineering, College of Engineering, University of Tehran, PO Box: 11155-4563, Tehran, Iran. Item in Clipboard Azita Abdollahi et al. J Phys Condens Matter. 2022. Show details Display options Display options Format AbstractPubMedPMID doi: 10.1088/1361-648X/ac6476. Affiliation 1 School of Mechanical Engineering, College of…
100+ Partners Bring NVIDIA Clara AI Healthcare Platform to Enterprises
Healthcare enterprises globally are working with NVIDIA to drive AI-accelerated solutions that are detecting diseases earlier from medical images, delivering critical insights to care teams and revolutionizing drug discovery workflows. NVIDIA Clara, a suite of software and services that powers AI healthcare solutions, is enabling this transformation industry-wide. The Clara…
Building a Predictive Model with Python and Scikit-learn
Python for Natural Language Processing In the world of data science and machine learning, predictive modeling is the practice of using data analysis and algorithms to create models that can predict future outcomes. Predictive models can be used for a variety of applications, such as predicting customer behavior, forecasting stock…
Excess calories during development may alter the brain and spur adult overeating
BNST→LHA connectivity is primarily GABAergic and is negatively correlated with early life growth rate. A. Experimental schematic. AAV-Syn-ChR2-eYFP was injected in BNST. B. Example of ChR2-eYFP expression in BNST. C. Whole-cell current clamp recordings were made from BNST:ChR2+ neurons to validate ChR2 functionality. D. Example BNST:ChR2+ neuron spiking in response…
How AlphaFold could redefine drug discovery with digital biology
[Christoph Burgstedt/Adobe Stock] At the Nvidia GTC 2023, DeepMind’s Founder and CEO, Demis Hassabis, provided an in-depth look into the seismic potential of their protein folding AI system, AlphaFold. Hassabis said AlphaFold was a contender for the organization’s “biggest project to date.” Hassabis noted that DeepMind’s AlphaFold has made strides…
Postdoc in bioinformatics and sequence analysis
The Center for Quantitative Genetics and Genomics (QGG) at Aarhus University invites applications for a position as Postdoc in the field of bioinformatics and sequence analysis as per 1 August 2023 or as soon as possible thereafter. Expected start date and duration of employmentThe position is a fixed-term full-time position…
Study finds different genes linked to depression in males and females
147 genes significantly associated with broad depression Depression is a complex psychological disorder that is twice as common in females than in males. It is also established that several genetic variants are associated with an increased risk of developing depression. In relation, the new research identified 11 areas of DNA…
Baptist Health is First in the State to Conduct Novel Liquid Biopsy in Brain Cancer Patient
March 22, 2023 – As part of an international clinical trial, Miami Cancer Institute and Miami Neuroscience Institute, part of Baptist Health South Florida, have conducted the first low-intensity focused ultrasound (LIFU) aided liquid biopsy in the state of Florida in a patient with glioblastoma, most aggressive form of brain cancer….
Domino Data Lab’s Spring Release Offers Accessible and Accelerated AI Innovation
Domino Data Lab, the enterprise MLOps platform company, is announcing updates to its platform that will drive accessibility to open source tools and techniques—including Ray 2.0, MLflow, and Feast’s feature store for machine learning (ML)—allowing enterprises to see tangible value from their AI, sooner. The announcement is also accompanied…
[Bug 2179414] Review Request: python-scikit-build-core
bugzilla.redhat.com/show_bug.cgi?id=2179414 Miro Hrončok <mhroncok@xxxxxxxxxx> changed: What |Removed |Added —————————————————————————- CC| |mhroncok@xxxxxxxxxx — Comment #14 from Miro Hrončok <mhroncok@xxxxxxxxxx> — See also src.fedoraproject.org/rpms/python-scikit-build-core/pull-request/3 — You are receiving this mail because: You are always notified about changes to this product and component You are on the CC list for the bug. bugzilla.redhat.com/show_bug.cgi?id=2179414…
Asia-Pacific Hearing Aid Market is Set to Boom Worldwide with
Asia-Pacific Hearing Aid Market analysis report covers detailed value chain analysis of the market. The value chain analysis helps to analyze major upstream raw materials, major equipment’s, manufacturing process, and downstream customer analysis and major distributor analysis are mentioned in the report along with all the drivers and restraints for…
The potential to produce tropodithietic acid by Phaeobacter inhibens affects the assembly of microbial biofilm communities in natural seawater
Falkowski, P. G., Barber, R. T. & Smetacek, V. Biogeochemical controls and feedbacks on ocean primary production. Science (1979) 281, 200–206 (1998). CAS Google Scholar Nemergut, D. R. et al. Patterns and processes of microbial community assembly. Microbiol. Mol. Biol. Rev. 77, 342–356 (2013). Article PubMed PubMed Central Google Scholar …
An improved hyperparameter optimization framework for AutoML systems using evolutionary algorithms
Feurer, M. & Hutter, F. Hyperparameter optimization. In Automated Machine Learning, The Springer Series on Challenges in Machine Learning 3–33. doi.org/10.1007/978-3-030-05318-5 (2018). Belete, D. M. & Huchaiah, M. D. Grid search in hyperparameter optimization of machine learning models for prediction of HIV/AIDS test results. Int. J. Comput. Appl. 44, 875–886….
Postdoc position in Bioinformatics – 3D chromatin architecture and non-codi
A fully supported postdoc position is immediately available at the Italian Institute of Technology (IIT) in Genova-Italy. The successful candidate will work in a multi-disciplinary team and will analyze in-house produced multi-omic data aiming to understand the role of non-coding RNAs in mediating 3D chromatin architecture in embryonic stem cells…
Convert Abricate output tsv file to gff3 format
Here’s one way using awk, that I think fulfills the requirements. It adds each of the column names (on the first line) to an array to make accessing each of the fields a bit easier. This approach isn’t strictly necessary, but it does make for a more readable solution in…
docker compose – Can’t login to my server jupyterhub via http – Stack Overflow
I’m trying to set up a jupyterhub on my server and access it via an external network. I’m new on it so I’m using this repo as a starting point. I changed jupyterhub_config.py to use a Dummy authenticator. The complete file looks like this: import os c = get_config() #…
Weights & Biases Announces Integrations with NVIDIA AI
SAN FRANCISCO, March 22, 2023 — Weights & Biases today announced integrations and validations with NVIDIA AI. The integrations will enable organizations adopting NVIDIA AI Enterprise, the software layer of the NVIDIA AI platform, to take advantage of the Weights & Biases MLOps platform to accelerate deep learning workloads across…
bayesian – How Naive Bayes makes prediction based on scikit-learn?
To understand the Naive Bayes ML algorithms, a good start is understanding the original Naive Bayes probability function and what conditional probability implies. Short answer : In your training data, you can “learn” inferences such as “what is the probability of seeing the word ‘money’ in spams“. You can create…
Academic pricing of iPSCs and iPSC derived cells
As a leading research lab working with iPSCs and iPSC derived cells, you’ll be wanting the consistency and quality that axoCellsTM provides. You’ll also be wanting peace of mind that the correct licenses are in place plus access to great scientific support from people who really know iPSCs. To support…
Merced Powersports > Shop Online > Parts Finder
Home › Shop Online › Parts Finder *#REQ indicates the total pieces used to complete the assembly. Price shown is per piece. Order the total number of pieces needed for repair. Ref # 001 Part # 78111-YB3-000 Description HOSE, SUCTION (4.5M) …
Postdoc (f/m/d) in Molecular Biology and Bioinformatics, Germany
The research group lIMMUNOMOD at the Institute of Molecular Virology at the University Medical Center in Ulm, Germany is seeking a highly motivated and interdisciplinary Postdoc with a strong interest in Molecular Biology and Bioinformatics to study how human pathogenic viruses interact with the host and each other. The successful…
Bioinformatician – Cancer Research (Melbourne, Australia)
Apply HERE: www.seek.com.au/job/66338853?type=standout#sol=7aa1e7675337a8352fbe779962671540ecd67524 Company description: Peter MacCallum Cancer Centre Job description: Outstanding candidates are encouraged to apply for positions now open at Peter MacCallum Cancer Centre – a place where our normal days are extraordinary; as are the people we care for. Peter Mac is one of a handful of…
Improving conversion of abricate tsv file to gff3 file
Since such a neat solution (abricate tsv to gff3) was provided by Steve, here are few other steps that I am looking to add so that the script progress to logical maturity to be usable by many others. I have two files – (1) fasta file with .fna extension, and…
KEGG ORTHOLOGY: K05026
KEGG ORTHOLOGY: K05026 ORTHOLOGY: K05026 Help Entry K05026 KO Symbol CLIC6 Name chloride intracellular channel protein 6 Brite KEGG Orthology (KO) [BR:ko00001] 09180 Brite Hierarchies 09183 Protein families: signaling and cellular processes 04040 Ion channels K05026 CLIC6; chloride intracellular channel protein 6Ion channels [BR:ko04040] Chloride channels Chloride channel, intracellular (CLIC) K05026 CLIC6; chloride intracellular channel protein 6 BRITE hierarchy…
Discover Top 4 AI Python Libraries with ChatGPT
Discover the Best AI and Machine Learning Libraries in Python with ChatGPT’s Help Image by Author Artificial intelligence(AI) and Machine learning have become increasingly important in today’s world, with applications ranging from self-driving cars, to face recognition an more. As a result, Python has become the go-to language for AI…
Advances in the application of induced pluripotent stem cells in pediatric diseases
The optimal diagnosis and treatment of pediatric diseases depend on more adequate understanding of pathophysiology. The advent of induced pluripotent stem cells (iPSCs) has provided new strategies for the research and therapy of pediatric diseases. iPSCs are pluripotent stem cells induced by reprogramming of mature cells. Now they can be…
Postdoctoral fellow in cancer genomics and bioinformatics
The University of Gothenburg tackles society’s challenges with diverse knowledge. 56 000 students and 6 600 employees make the university a large and inspiring place to work and study. Strong research and attractive study programmes attract scientists and students from around the world. With new knowledge and new perspectives, the…
What makes a valid username on JupyterHub / TLJH? – The Littlest JupyterHub
Hi! As a hub admin I wondered what consists a valid username for hub users. Are there any pitfalls with special characters, etc? Is it a good idea to use someones email address for example? I could not find any info on this here manics March 24, 2023, 7:29pm 2…
KEGG ORTHOLOGY: K08765
Brite KEGG Orthology (KO) [BR:ko00001] 09100 Metabolism 09103 Lipid metabolism 00071 Fatty acid degradation K08765 CPT1A; carnitine O-palmitoyltransferase 1, liver isoform 09130 Environmental Information Processing 09132 Signal transduction 04152 AMPK signaling pathway K08765 CPT1A; carnitine O-palmitoyltransferase 1, liver isoform 09150 Organismal Systems 09152 Endocrine system 04922 Glucagon signaling pathway K08765 CPT1A; carnitine O-palmitoyltransferase 1, liver isoform 04920 Adipocytokine signaling pathway K08765 CPT1A; carnitine O-palmitoyltransferase 1, liver isoform 03320 PPAR…
refstack-client: autopkgtest regression: Invalid version: ‘0.0.0.02021.08.18.fa73ef2524’
Source: refstack-client Version: 0.0.0~2021.08.18.fa73ef2524-4 Severity: serious User: debian…@lists.debian.org Usertags: regression Dear maintainer(s), Your package has an autopkgtest, great. However, it recently (around beginning of February 2023) started to fail in testing. Paul ci.debian.net/data/autopkgtest/testing/amd64/r/refstack-client/32427783/log.gz Traceback (most recent call last): File “/tmp/autopkgtest-lxc.zvo2tfw5/downtmp/build.pFl/src/setup.py”, line 27, in setuptools.setup( File “/usr/lib/python3/dist-packages/setuptools/__init__.py”, line 108, in setup…
AI At All Levels From Udacity
AI may be threatening to take away our jobs – but on the other hand it opens up plenty of opportunities for those with the right skills. A whole raft of Udacity Artificial Intelligence Nanodegree programs restart next week to help you become career-ready in AI. Disclosure:…
Transfection Reagents and Equipment Global Market Report
Dublin, March 21, 2023 (GLOBE NEWSWIRE) — The “Transfection Reagents and Equipment Market by Product, by Method, by Application, by End User, and by Region – Global Forecast to 2022-2033” report has been added to ResearchAndMarkets.com‘s offering. The transfection reagents and equipment market size are estimated to be USD 1,147.2…
China approves its first mRNA Covid-19 vaccine
China has approved its first Covid-19 vaccine based on mRNA technology, months after the country lifted strict pandemic measures. The vaccine was developed by CSPC Pharmaceutical Group, a homegrown firm based in the northern Chinese city of Shijiazhuang, it said in a Wednesday statement to the Hong Kong stock exchange….
SVM with Univariate Feature Selection in Scikit Learn
Support Vector Machines (SVM) is a powerful machine learning algorithm used for classification and regression analysis. It is based on the idea of finding the optimal boundary between two classes that maximizes the margin between them. However, the challenge with SVM is that it requires a large amount of computational…
Correction: Directed differentiation of human iPSCs to functional ovarian granulosa-like cells via transcription factor overexpression
Pierson Smela MD, Kramme CC, Fortuna PRJ, Adams JL, Su R, Dong E, Kobayashi M, Brixi G, Kavirayuni VS, Tysinger E, Kohman RE, Shioda T, Chatterjee P, Church GM. 2023. Directed differentiation of human iPSCs to functional ovarian granulosa-like cells via transcription factor overexpression. eLife 12:e83291. doi: 10.7554/eLife.83291. Published 21…
RefSeq: NC_011742 CDS #1879
RefSeq: NC_011742 CDS #1879 >NC_011742 (refseq) complement(1921794..1922843) /translation= MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS EMIAEKVRTAAKASLAAHKPLSVPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI BLAST Read more here: Source link
ChatGPT is an expert in SageMath too
On Friday, 24 March 2023 at 13:04:48 UTC-7 William Stein wrote: The code it suggests next doesn’t work, but to me that seems like a bug in Sage (?). Omitting the P entirely does work. — William — Not a bug in sage, but a more insidious error in the example…
Postdoc Bioinformatics – Dataset Integration (m / f / d) Job Vacancy
Description: The German Center for Neurodegenerative Diseases (DZNE) is a world-leading internationally oriented research center, committed to discovering new approaches to prevent and treat neurodegenerative diseases. To this end, researchers at ten DZNE sites across Germany pursue a translational and interdisciplinary strategy comprising five interconnected areas: fundamental research, clinical research,…
MapSplice2 gives error if the thread count (-p value) is greater than 2
MapSplice2 gives error if the thread count (-p value) is greater than 2 1 Hello! I get a multi-threading error while using MapSplice2. All the reference fasta files and index files were generated accordingly, as mentioned in the website. (www.netlab.uky.edu/p/bioinfo/MapSplice2UserGuide) I get an error after it evaluates given files/parameters but…
Content not found
Sorry but the page you were looking for has not been found. We suggest you navigate back here up a level: /conference/festival-of-biologics-usa » What can you do now? Well you could try going back to the last page you visited and then browsing somewhere else, alternatively you…
MSigDB SQLite Database – GeneSetEnrichmentAnalysisWiki
From GeneSetEnrichmentAnalysisWiki GSEA Home | Downloads | Molecular Signatures Database | Documentation | Contact Introduction With the release of MSigDB 2023.1 we have created a new SQLite database for the fully annotated gene sets in both the Human (2023.1.Hs) and the Mouse (2023.1.Ms) resources. Each ships as a single-file database…
Regex Problem using Import tool on QIIME2 for Galaxy – qiime
I’m trying to use the ‘qiime2 tools import’ for SampleData[SequencesWithQuality] with ‘Single Lane Per Sample Single End Fastq Directory Format’.I think I’ve correctly build the manifest and metada files. But I keep getting the same persistent error regarding the element ‘name’.This parameter asks me for “Filename to import the data…
[Errno 2] No such file or directory
Source: apbs Version: 3.4.1-5 Severity: serious Tags: bookworm-ignore User: debian…@lists.debian.org Usertags: regression Control: found -1 3.0.0+dfsg1-3 Dear maintainer(s), Your package has an autopkgtest, great. However, it started to fail in testing (October 2022). As it started to fail in stable around the same time, I rather expect some external dependency,…
KEGG COMPOUND: C00916
KEGG COMPOUND: C00916 COMPOUND: C00916 Help Entry C00916 Compound Name Formula C16H21N3O8S Exact mass 415.1049 Mol weight 415.4182 Structure Mol fileKCF fileDB search Reaction Pathway map00311 Penicillin and cephalosporin biosynthesis map01110 Biosynthesis of secondary metabolites map07012 Cephalosporins – parenteral agents map07013 Cephalosporins – oral agents Enzyme Brite Compounds with biological…
Oncotarget | Attenuation of cancer proliferat
image: Figure 6: Overexpression of GPC1 increases proliferation of T24 cells. view more Credit: 2023 Cheng et al. “This study was designed to increase the knowledge on the potential of GPCs and in particular GPC1 as a biomarker in cancer diagnosis and prognosis.” BUFFALO, NY- March 22, 2023 – A new…
mRNA Extraction and Purification Market Latest Trends and Future Opportunities Analysis to 2030
PRESS RELEASE Published March 24, 2023 mRNA Extraction and Purification Market to Record an Exponential CAGR by 2030 – Exclusive Report by InsightAce Analytic InsightAce Analytic Pvt. Ltd. has announced the publication of a market research report titled “Global mRNA Extraction and Purification Market– By Product (Kits/Reagents, Instruments) End-user (Academics…
Cas12a/Guide RNA-Based Platforms for Rapidly and Accurately Identifying Staphylococcus aureus and Methicillin-Resistant S. aureus
In order to ensure the prevention and control of methicillin-resistant Staphylococcus aureus (MRSA) infection, rapid and accurate detection of pathogens and their resistance phenotypes is a must. Therefore, this study aimed to develop a fast and precise nucleic acid detection platform for identifying S. aureus and MRSA. We initially constructed…
sagemath – Evaluating LaTeX input
I frequently use desmos, and when I copy equations and expressions, desmos gives these in $\LaTeX$. Is it possible for sagemath to interpret the $\LaTeX$ code and make a sagemath object of it? Say for example i have the $\LaTeX$ expression: $$\frac{ab+\sqrt{a^{2}+b^{2}-1}}{a^{2}-1}$$ Then I would like to get something I…
Postdoctoral researcher: microbiome bioinformatics and metagenomics
The Laboratory of Food Systems Biotechnology (FSB) develops computational methods and utilizes “omics” technologies to study microbial ecosystems in food production and human health, with the ultimate goal of creating microbial communities and products that optimize food quality, safety, and human health. We are seeking a postdoctoral researcher with expertise…
GFP Stably expressing CHO Cell Line
The CHO cell line is an adherent epithelial cell derived from the ovary of Chinese hamster. It is widely used in biology and medical research of genetics, toxicity screening, nutrition, and gene expression, particularly to express recombinant proteins. CHO cells are the most common mammalian hosts for industrial production of…
KEGG COMPOUND: C00696
KEGG COMPOUND: C00696 COMPOUND: C00696 Help Entry C00696 Compound Name Prostaglandin D2;(5Z,13E)-(15S)-9alpha,15-Dihydroxy-11-oxoprosta-5,13-dienoate;(5Z,13E,15S)-9alpha,15-Dihydroxy-11-oxoprosta-5,13-dienoate;PGD2 Formula C20H32O5 Exact mass 352.225 Mol weight 352.4651 Structure Mol fileKCF fileDB search Reaction Pathway map04080 Neuroactive ligand-receptor interaction map04664 Fc epsilon RI signaling pathway Enzyme Brite Compounds with biological roles [BR:br08001] Lipids Eicosanoids Prostaglandins C00696 Prostaglandin D2Lipids [BR:br08002] FA Fatty acyls FA03 Eicosanoids FA0301 Prostaglandins C00696 Prostaglandin D2…
The oncogenic properties of the EWSR1::CREM fusion gene are associated with polyamine metabolism
Knockdown of EWSR1::CREM and CREM expression in CHL-1 cell line induced senescence and reduced proliferation and migration Loss of EWSR1::CREM fusion protein in CHL-1 has previously been found to be associated with reduced proliferation, senescence and impaired invasion3. To validate these findings, we investigated the cellular properties associated with endogenous…