Dynamically reorganized chromatin is the key for the reprogramming of somatic cells to pluripotent cells
Citation: Kaimeng Huang*, Xiaobai Zhang*, Jiejun Shi*, Mingze Yao, Jiannan Lin, Jiao Li, He Liu, Huanhuan Li, Guang Shi, Zhibin Wang, Biliang Zhang, Jiekai Chen, Guangjin Pan, Cizhong Jiang, Duanqing Pei, and Hongjie Yao. 12/7/2015. “Dynamically reorganized chromatin is the key for the reprogramming of somatic cells to pluripotent cells.”…
Move Cytoscape “CytoscapeConfiguration” directory
Move Cytoscape “CytoscapeConfiguration” directory 1 Hi Lucy, Well, you could set up a symbolic link from the user’s home directory to another directory, but Cytoscape will always look in the user’s home directory for CytoscapeConfiguration. — scooter Login before adding your answer. Read more here: Source link
Finding dbSNP 129 rsIDs for lifting over hg18 sumstats to hg38
Finding dbSNP 129 rsIDs for lifting over hg18 sumstats to hg38 0 Hi all, I’m currently working on lifting a summary statistics file from the genome build hg18 to hg38. The file format for the sumstats is as follows: marker Allele1 Allele2 beta1 SE pValue chr Bp chr10:100004799 a c…
Aerial transport of bacteria by dust plumes in the Eastern Mediterranean revealed by complementary rRNA/rRNA-gene sequencing
Katra, I. et al. Richness and diversity in dust stormborne biomes at the Southeast Mediterranean. Sci. Rep. 4, 5265 (2014). Article CAS Google Scholar Kellogg, C. A. & Griffin, D. W. Aerobiology and the global transport of desert dust. Trends Ecol. Evolution 21, 638–644 (2006). Article Google Scholar Mazar, Y.,…
Debian — Details of package r-bioc-pwmenrich in bullseye
PWM enrichment analysis A toolkit of high-level functions for DNA motif scanning and enrichment analysis built upon Biostrings. The main functionality is PWM enrichment analysis of already known PWMs (e.g. from databases such as MotifDb), but the package also implements high-level functions for PWM scanning and visualisation. The package does…
Galapagos NV (GLPG) announces topline results from Phase 3 DIVERSITY trial of filgotinib in Crohn’s disease
News and research before you hear about it on CNBC and others. Claim your 1-week free trial to StreetInsider Premium here. The two induction cohorts missed the co-primary endpoints of clinical remission and endoscopic response at Week 10 In the maintenance phase, filgotinib 200mg once daily achieved the co-primary endpoints…
PacBio to Expand MAS-Seq Technology to 16S rRNA and Bulk RNA-Seq Solutions
End-to-End Solutions Planned to Support Key Customer Applications With Increased Cost Flexibility on Long-Read Sequencing Systems MENLO PARK, Calif., Feb. 7, 2023 /PRNewswire/ — PacBio (NASDAQ: PACB), a leading developer of high-quality, highly accurate sequencing solutions, today announced the commencement of a program intended to expand Multiplexed Arrays Sequencing (MAS-Seq)…
Conditional aes in ggplot – shiny
Is there away to add a conditional aes to a ggplot? I am trying to build a function that generates a kernel plot but I want allow the function user the option to toggle weights on and off. I know I could write it as if ( toggle_on = TRUE)…
Nexus between genome-wide copy number variations and autism spectrum disorder in Northeast Han Chinese population | BMC Psychiatry
WHO. Autism spectrum disorders and other developmental disorders: From raising awareness to building capacity. Geneva: World Health Organization; 2013. Google Scholar Sahin M, Sur M. Genes, circuits, and precision therapies for autism and related neurodevelopmental disorders. Science. 2015;350:6263. Kim JY, Son MJ, Son CY, Radua J, Eisenhut M, Gressier F,…
PacBio to Expand MAS-Seq Techn
MENLO PARK, Calif., Feb. 7, 2023 End-to-End Solutions Planned to Support Key Customer Applications With Increased Cost Flexibility on Long-Read Sequencing Systems MENLO PARK, Calif., Feb. 7, 2023 /PRNewswire/ — PacBio (NASDAQ: PACB), a leading developer of high-quality, highly accurate sequencing solutions, today announced the commencement of a program intended…
Inconsistent dipole moment from PRINT and total density cube file
Hello, Question: I tried to print the dipole moment of my system via the section CP2K_INPUT/FORCE_EVAL/DFT/PRINT/MOMENTS (manual.cp2k.org/trunk/CP2K_INPUT/FORCE_EVAL/DFT/PRINT/MOMENTS.html), and got the result in the standard output file. However, this value does not match the number I got from either 1) total charge density cube file (multiply the grid and the charge…
r – Where to properly position ggplotly tooltip in ggplot?
When I add a text line to a geom_line plot, the line disappears. library(tidyverse) library(“lubridate”) library(plotly) library(“RColorBrewer”) library(htmlwidgets) library(“reprex”) activity <- c(“N”, “FB”, “N”, “N”, “N”, “FA”, “N”, “FA”, “N”, “FA”, “N”, “N”, “N”, “N”, “N”, “FA”, “N”, “N”, “N”, “N”, “FA”, “N”, “N”, “FA”, “FA”) activity_date <- as.Date(c(NA, “2022-04-19”,…
Sotorasib versus docetaxel for previously treated non-small-cell lung cancer with KRASG12C mutation: a randomised, open-label, phase 3 trial
Background Sotorasib is a specific, irreversible inhibitor of the GTPase protein, KRASG12C. We compared the efficacy and safety of sotorasib with a standard-of-care treatment in patients with non-small-cell lung cancer (NSCLC) with the KRASG12C mutation who had been previously treated with other anticancer drugs. Methods We conducted a randomised, open-label…
R LANGUAGE GGPLOT DATA VISUALIZATION R
R LANGUAGE GGPLOT DATA VISUALIZATION R SOFTWARE CHOOSE ONE APPROPRIATE CHART TO PERFORM AND SUMMARIZE ABOUT DATA ISSUES AND THE MODEL CHART THAT YOU CHOOSE. HW2Q4.txt “init.age” “init.year” “death.age” “death.year” “sex” “race” “income” “smoking” “health”“1” 60 2008 69 2017 “Female” “Black” 15000 “Non-smoker” 87.6“2” 29 2001 46 2018 “Female” “East…
Researcher/postdoctoral researcher in next-gen sequencing and bioinformatics
Let’s shape the future – University of Antwerp The University of Antwerp is a dynamic, forward-thinking, European university. We offer an innovative academic education to more than 20 000 students, conduct pioneering scientific research and play an important service-providing role in society. We are one of the largest, most international and most innovative…
Developer required for VR data visualization – Job in Data Science And Analytics
Need to create a short demo of data visualization in VR on a Oculus Quest. Need to create 3 levels of hierarchy , with each level showing 2-3 metrics . Need to get the data pulled from Excel and plot it on an interactive graph . The graph should be…
Solved a. Explain (with drawings too, if you’d like!) how
Transcribed image text: a. Explain (with drawings too, if you’d like!) how droplet single-cell mRNA sequencing works at the molecular level. (3pts) b. Why is this so useful? What can this technology offer that we don’t get with bulk DNA sequencing, RNA sequencing, or simpler single-cell RNA sequencing methods (like…
AI threats and open-source vulnerabilities top host of security issues facing cloud-native community
It turns out that security concerns in the cloud-native world look a lot like what’s keeping practitioners up at night in the rest of the technology ecosystem. Implementation of zero-trust security in the enterprise, supply chain vulnerability, threats to cryptography from quantum computing, and the rise of powerful artificial intelligence…
Have model organisms evolved too far?
Genome comparison of different E. coli K-12 strains. The figure shows the comparison of the WG1 chromosome (contig 1) and F plasmid (contig 2) with the genomes of EMG2, MG1655 (NC_000913.3) and W3110 (NC_007779.1), using the Proksee Server (19). The outer two rings display the genes and features of the…
Paul Flicek, D.Sc. joins JAX as inaugural chief data science officer to build global data science initiative
BAR HARBOR, Maine, Feb. 8, 2023 /PRNewswire/ — The Jackson Laboratory (JAX) has appointed world-class data scientist Paul Flicek, D.Sc., as its inaugural chief data science officer (CDSO). In this new leadership role, Flicek will be responsible for building and executing a comprehensive data science strategy across JAX. “Dr….
Meta And Mark Zuckerburg Are Pulling Back From The Metaverse
Facebook’s parent company Meta has shown a strong interest in artificial intelligence and has been investing heavily in AI research and development. They use AI for various tasks such as computer vision, natural language processing, recommendation systems, and more. The company has also open-sourced numerous AI tools and libraries, such…
USC Stem Cell-led studies point the way to br
image: Human induced motor neurons that are labeled with a motor neuron marker HB9 in green and a neuron marker TUJ1 in purple. view more Credit: Ichida Lab Each year in the U.S., 5,000 patients receive a diagnosis of ALS, an incurable neurodegenerative disease that will likely kill them within two…
EPCAM Hu-Cyanine 5 SmartFlare Probe
EPCAM Hu-Cyanine 5 SmartFlare Probe | Merck Life Science Indonesia The store will not work correctly in the case when cookies are disabled. JavaScript seems to be disabled in your browser. For the best experience…
Google AI Open Sources Vizier: A Standalone Python Package Designed For Managing And Optimizing Machine Learning Experiments At Scale
A variant of the Vizier system called Google Open Source Vizier was created and made available as open-source software by Google. With Google’s cloud computing infrastructure, including products like Google Cloud AI Platform and Google Kubernetes Engine, this version of Vizier has been created and optimized for use. Google Open…
Dr Eleonora Lad Highlights the Importance of Upcoming Pegcetacoplan Results
With no treatment options currently available for geographic atrophy (GA), an advanced form of dry age-related macular degeneration (AMD), pegcetacoplan could fill a huge unmet need, explained Eleonora Lad, MD, PhD, associate professor of ophthalmology, Duke University. The drug is currently under review for approval with the FDA, which is…
Research Assistant in Computational Biology job with KINGS COLLEGE LONDON
Job description We are looking for a talented research assistant with a passion and aptitude for advanced data analysis to join the Bioinformatics Core at the Centre for Developmental Neurobiology, King’s College London. The successful candidate will take up a central role in processing diverse types of data…
Cassava Sciences Announces Patient Enrollment Update for Phase 3 Studies of Simufilam for the Treatment of Alzheimer’s Disease
Cassava Sciences, Inc. AUSTIN, Texas, Feb. 08, 2023 (GLOBE NEWSWIRE) — Cassava Sciences, Inc. (Nasdaq: SAVA), a clinical-stage biotechnology company, today announced an update on patient enrollment for its on-going Phase 3 clinical studies of simufilam for the treatment of Alzheimer’s disease dementia. Simufilam, an oral drug, is Cassava Sciences’…
Monoclonal antibody production and glycosylation of a CHO cell line in three commercial media
Recombinant monoclonal antibodies and other therapeutic proteins are largely produced using Chinese hamster ovary (CHO) cells. After selection of a high producing clone, choice of the growth medium for cell culture and production in bioreactors becomes critical. The chemical composition of the cell culture medium plays important roles in the…
Research Fellow (Extreme Weather Forecasting) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description Mengaldo’s Laboratory is looking for a self-motivated, proactive and highly creative Postdoctoral Fellow in dynamical system theory and machine learning for extreme weather forecasting applications. The ideal candidate should be skilled in coding, and software development, and be highly proficient in Python, large-scale spatio-temporal data analysis (ideally the…
CD19 CAR-T agents to boost blood cancer market
GlobalData says CD19 CAR-T agents are expected to treat over 13,000 blood cancer patients annually by 2031, driving sales of Breyanzi and Yescarta. Research from data and analytics company GlobalData shows that the use of CD19 chimeric antigen receptor T-cell (CAR-T) agents for blood cancer is set to significantly increase…
Index of /refseq/release
Name Last modified Size Parent Directory – announcements/ 2023-01-13 02:35 – archaea/ 2023-01-13 08:03 – bacteria/ 2023-01-13 07:03 – complete/ 2023-01-13 15:33 – fungi/ 2023-01-13 15:40 – invertebrate/ 2023-01-13 08:35 – mitochondrion/ 2023-01-13 07:05 – other/ 2023-01-13 15:33 – plant/ 2023-01-13 03:03 – plasmid/ 2023-01-13 03:06 – plastid/ 2023-01-13 15:35…
Postdoctoral Researcher in Bioinformatics job with UNIVERSITY OF SYDNEY
Full-time 12 -24-month fixed-term position Postdoctoral Research Fellow (Level B or Level C) in the Imaging and Phenotyping Laboratory Located at the Charles Perkins Centre on the Camperdown Campus Base salary starting from $113, 184 to $159, 867 plus 17% superannuation About the opportunity The Imaging…
BRIEF-Cassava Sciences Announces Patient Enrollment Update For Phase 3 Studies Of Simufilam For The Treatment Of Alzheimer’S Disease
Welcome to Kalkine Media Pty Ltd. website. Your website access and usage is governed by the applicable Terms of Use & Privacy Policy. Welcome to Kalkine Media LLC website. Your website access and usage is governed by the applicable Terms and Conditions & Privacy Policy. Welcome to Kalkine Media New…
Gene amplification of the menkes (MNK; ATP7A) P-type ATPase gene of CHO cells is associated with copper resistance and enhanced copper efflux
journal contribution posted on 2023-02-07, 23:51 authored by J Camakaris, MJ Petris, L Bailey, P Shen, P Lockhart, TW Glover, CL Barcroft, J Patton, Julian MercerJulian Mercer Three copper-resistant variants of cultured Chinese hamster ovary (CHO) cells were isolated and each was shown to accumulate less intracellular copper than the…
Identification of brain cell types underlying genetic association with word reading and correlated traits
Lyon GR. Part I defining dyslexia, comorbidity, teachers’ knowledge of language and reading. Ann Dyslexia. 2003;53:1–14. Google Scholar Hendren RL, Haft SL, Black JM, White NC, Hoeft F. Recognizing psychiatric comorbidity with reading disorders. Front Psychiatry 2018;9:101. Google Scholar Doust C, Fontanillas P, Eising E, Gordon SD, Wang Z, Alagoz…
How IBM’s new supercomputer is making AI foundation models more enterprise-budget friendly
Check out all the on-demand sessions from the Intelligent Security Summit here. Foundation models are changing the way that artificial intelligence (AI) and machine learning (ML) are able to be used. All that power comes with a cost though, as building AI foundation models is a resource-intensive task. IBM announced…
installation of bioclite gives an error
installation of bioclite gives an error 1 Hello everyone, I am trying to install biocLite using BiocManager::install function in rstudio but its giving me an error. BiocManager::install(“biocLite”) Warning message: package ‘biocLite’ is not available for Bioconductor version ‘3.16’ A version of this package for your version of R might be…
Galapagos announces topline results from Phase 3 DIVERSITY
The two induction cohorts missed the co-primary endpoints of clinical remission and endoscopic response at Week 10 In the maintenance phase, filgotinib 200mg once daily achieved the co-primary endpoints of clinical remission and endoscopic response at Week 58 The safety findings were generally consistent with the known profile of filgotinib…
Nonalcoholic Steatohepatitis Linked to Inflammation-Related Liver Cell Signature
NEW YORK – Using single-nucleus transcriptome sequencing and epigenomic profiling, a University of Pennsylvania-led team has teased out liver cell features linked to an advanced form of nonalcoholic fatty liver disease (NAFLD) called nonalcoholic steatohepatitis (NASH), identifying a group of hepatocyte liver cells marked by a cell adhesion- and migration-related…
Telomere-to-mitochondria signalling by ZBP1 mediates replicative crisis
Cell culture IMR90 (CCL-186) and WI38 (AG06814-N) fibroblasts were purchased from ATCC and the Coriell Institute for Medical Research, respectively. IMR90 and WI38 fibroblasts were grown under 7.5% CO2 and 3% O2 in GlutaMax-DMEM (Gibco, 10569-010) supplemented with 0.1 mM non-essential amino acids (Corning, 25-025-Cl) and 15% fetal bovine serum (VWR/Seradigm,…
RefSeq: NC_012925 CDS #220
RefSeq: NC_012925 CDS #220 >NC_012925 (refseq) 241141..242079 /translation= MVSTVTTLGGFTFDNCLMNAAGVWCMTKEELDAVKNSKAGTFVTKTATLDYRAGNPEPRY QNVPLGSINSMGLPNQGLAYYLDYLLELQETEPERTFVLSVVGMSPDETHEILRTVEASD FKGLTELNLSCPNVPGKPQIAYDFETTETILQEVFTYFTKPLGIKLPPYFDIVHFDQAAA IFNQFPLKFVNCVNSIGNGLYIKDESVVIKPKNGFGGIGGEYIKPTALANVHAFYQRLKP EIQIVGTGGILTGRDAFEHILCGASMVQVGTTLQKEGVAAFGRITAELQAIMAEKGYETI EDFRGKLQHLDD BLAST Read more here: Source link
The Next Phase of Infinity Saga Variant Covers is Coming!
If you’ve been enjoying Marvel Comics line of Infinity Saga variant covers then get ready because there’re more to come! Done as incredible poster-style pieces, each of these covers honors a specific film in the Marvel Cinematic Universe brought to life by the talents of some of the industry’s most…
Viruses that Cause Cancer Recruit Human Protein to Evade Immune Response
Credit: xfzsy/Getty Images Viruses have evolved with humans for millions of years, so it’s no surprise they’ve evolved tricks to evade our natural, or innate, immune responses. Unfortunately, it’s often unclear what these tricks are. But now, thanks to researchers at the University of North Carolina (UNC) School of Medicine,…
Brain tumor, a simple urine test can help early diagnosis-breakinglatest.news-Breaking Latest News
22 A team of Japanese researchers has discovered two key proteins detectable in urine and associated with the development of cancer. Identify the brain tumor through a simple urine analysis could favor the early diagnosis. Taking a significant step forward in this direction, a study, published in the journal of…
Fact Check: Do Covid vaccines add a third strand to double-stranded DNA?
Quick Take A video on social media claims covid vaccines add a third strand to double-stranded DNA. We fact-checked and found the claim to be False. The Claim A TikTok video shared on Twitter shows a woman claiming covid vaccines add a third strand to the DNA. From the format,…
Quantifying Hepatitis B Viral Reservoirs in the Liver
Worldwide, more than 300 million people are chronically infected with hepatitis B virus (HBV). Chronic HBV, an infection that lasts 6 months or longer, is not susceptible to hepatitis B vaccination. People living with chronic HBV are at high risk of liver cirrhosis or hepatocellular carcinoma, and in urgent need…
Cassava Sciences (SAVA) Announces Patient Enrollment Update for Phase 3 Studies of Simufilam for the Treatment of Alzheimer’s Disease
News and research before you hear about it on CNBC and others. Claim your 1-week free trial to StreetInsider Premium here. Cassava Sciences, Inc. (Nasdaq: SAVA), a clinical-stage biotechnology company, today announced an update on patient enrollment for its on-going Phase 3 clinical studies of simufilam for the treatment of…
Illumina delivers first NovaSeq X Plus sequencer to the Broad Institute
New data on NovaSeq X Plus and workflow insights on Illumina Complete Long Reads unveiled at AGBT HOLLYWOOD, Fla., Feb. 8, 2023 /PRNewswire/ — Illumina Inc. (NASDAQ: ILMN), a global leader in DNA sequencing and array-based technologies, today announced that its first NovaSeq X Plus system was recently delivered to…
Phase 3 Antelope Trial Highlights Similarities in Efficacy, Safety With Biosimilar Natalizumab
In the recently published phase 3 Antelope trial (NCT04115488), biosimilar natalizumab (biosim-NTZ), or PB006, the first biosimilar monoclonal antibody developed for multiple sclerosis (MS), matched reference natalizumab (ref-NTZ; Tyasbri; Biogen) in efficacy, safety, and immunogenicity in treating patients with relapsing-remitting MS (RRMS). After 24 weeks of treatment, the model-based mean…
What is a holobiont and why can it change our understanding of the world? | Science & Tech
In nature, competition reigns and the strongest survive. Or, at least, that’s what we’ve often heard. But the planet is much more complicated than that, because we earthlings relate to other species at levels that we often don’t realize. As the biologist Lynn Margulis and the writer Dorion Sagan once…
New England Journal of Medicine Publishes Positive Phase 3 TOGETHER Results with Peginterferon Lambda in COVID-19
– Phase 3 TOGETHER data showed early treatment with a single dose of peginterferon lambda (Lambda) in patients with mild-to-moderate COVID-19 infections resulted in significantly decreased clinical events – Lambda reduced risk of hospitalization or emergency room visits by 51% (primary endpoint) – Lambda reduced risk of hospitalization by 42%…
Complete Genomics looks to rival Illumina with new sequencer
Complete Genomics, a U.S. firm affiliated with Chinese sequencing giant BGI, on Tuesday announced plans to launch a new line of sequencers it says can decode DNA in larger amounts — and at lower costs — than any instrument on the market. The company claims the sequencer, dubbed DNBSEQ-T20, can…
Sustainable computer memory, AI for autophagy and more: News from the College | Imperial News
Here’s a batch of fresh news and announcements from across Imperial. From AI being used to identify key proteins in cell degradation, to a shellfish component being used in sustainable computer memory devices, here is some quick-read news from across the College. AI for autophagy A team led by Dr…
Bayer begins key tests for closely watched blood thinner
Bayer is making one of the largest drug development bets in its history, advancing a pair of Phase 3 trials for a blood-thinning drug it believes can become a top-selling medicine in the future. The drugmaker said Wednesday the first patients have been enrolled in the trials, known respectively as…
Simultaneous Sequencing of Genetic and Epigenetic DNA Bases
Commonly used sequencing approaches do not capture full information from both genetics and epigenetics. Some of these may involve separate, parallel workflows and sequencing to produce full information, which may increase sample requirements, cost, and time, or produce data with no phased information. Researchers from the University of Cambridge and…
AlphaFold2 reveals commonalities and novelties in protein structure space for 21 model organisms
Proportion of AlphaFold2 models that can be brought into CATH Identification of domains in AF2 protein models We applied an in-house Hidden-Markov Model-based protocol CATH-Resolve-Hits (CRH)26 to assign domain regions in all sequences from the 21 model organisms modelled by AlphaFold2 (AF2) (see “Methods” for description and Fig. 1). CRH identifies…
Single-dose treatment reduces COVID-19 hospitalization risk by half for high-risk patients in phase 3 trial
Credit: University Health Network A single-dose of the antiviral drug peginterferon lambda reduced by half the risk of hospitalization or a visit to the Emergency Department due to COVID-19, according to a study published today in the New England Journal of Medicine. The multi-center phase 3 TOGETHER clinical trial—designed to…
Genomic risk factors for AMD mapped by researchers
The researchers pointed out in a news release the new discovery enhances our understanding of the previously unknown function of genomic regions outside the genes. (Adobe Stock image) Researchers at Tel Aviv University identified a new genetic risk factor for the complex eye disease age-related macular degeneration (AMD), a leading…
Develop applications using Tekla Open API
You can develop your own applications and additional features for Tekla Structures through the Tekla Open API (application programming interface). The Tekla Open API is implemented using Microsoft .NET technology. Applications that are developed using the Tekla Open API to work with Tekla Structures are called extensions. To develop your…
Novel Food Information: Herbicide Tolerant and Pest Resistant Maize line 4114
On this page Background Health Canada has notified Pioneer Hi-Bred Production LP that it has no objection to the food use of herbicide tolerant and pest resistant maize line 4114. The Department conducted a comprehensive assessment of this variety according to its Guidelines for the Safety Assessment of Novel Foods….
Roche reports positive results for crovalimab as rare blood disease treatment
Roche has announced positive results from its phase 3 study of crovalimab in patients with paroxysmal nocturnal haemoglobinuria (PNH), a rare and life threatening blood condition. PNH causes a patient’s red blood cells to break apart, resulting in a range of debilitating symptoms such as anaemia, fatigue, blood clots and…
KEGG T30861: 56979
Entry 23231 CDS T30861 Symbol 46_SUR_0-0d2_scaffold35130_1_gene23231 Name strand:- start:1 stop:1260 length:1260 start_codon:yes stop_codon:nogene_type:incomplete KO K00134 glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12] Best hit abo:ABO_1031 (best score: 683.33) Taxonomy Gammaproteobacteria – Others [GN:abo]Taxonomy Pathway 00010 Glycolysis / Gluconeogenesis 00710 Carbon fixation in photosynthetic organisms 01100 Metabolic pathways 01110 Biosynthesis of secondary metabolites 01120 Microbial metabolism…
Surface Microbial Diversity at the Detection Limit within the Vicinity of the Concordia Station, Antarctica
Concordia Research Station and sampling sites. (A) Map of Antarctica showing the Concordia Research Station at Dome C (B); sampling site L1 at 10 m (C); sampling site L2 at 500 m (D); and sampling site L3 at 1000 m (E). (A–E) photo credit: European Space Agency. The Concordia Research…
Download sbt-openapi JAR file with all dependencies
<dependency> <groupId>com.enfore</groupId> <artifactId>sbt-openapi</artifactId> <version>1.3.6</version> </dependency> <!– Thanks for using jar-download.com –> compile group: ‘com.enfore’, name: ‘sbt-openapi’, version: ‘1.3.6’ //Thanks for using jar-download.com <dependency org=”com.enfore” name=”sbt-openapi” rev=”1.3.6″/> <!– Thanks for using jar-download.com –> libraryDependencies += “com.enfore” % “sbt-openapi” % “1.3.6” //Thanks for using jar-download.com Read more here: Source link
The chances of Phase 3 success, and the ASX health stocks that are close a home run
What is the probability of having Phase 3 success, and is Phase 4 required? Stockhead reached out to Cynata’s CMO, Dr Jolanta Airey We look at ASX stocks with ongoing Phase 3 trials In order to progress to the Phase 3 clinical trials, a drug must have demonstrated promising…
KEGG T01088: 103635163
Entry 103635163 CDS T01088 Name (RefSeq) hydroxyethylthiazole kinase KO K00878 hydroxyethylthiazole kinase [EC:2.7.1.50] Organism zma Zea mays (maize) Pathway zma00730 Thiamine metabolism zma00740 Riboflavin metabolism zma01100 Metabolic pathways zma01240 Biosynthesis of cofactors Module zma_M00899 Thiamine salvage pathway, HMP/HET => TMP Brite KEGG Orthology (KO) [BR:zma00001] 09100 Metabolism 09108 Metabolism of cofactors and vitamins 00730 Thiamine metabolism 103635163 00740…
Whole-body adipose tissue multi-omic analyses in sheep reveal molecular mechanisms underlying local adaptation to extreme environments
RNA-Seq data Across all 250 adipose tissue samples, a total of 1780 Gb of clean reads were retained with an average of 23.7 million reads (14.6–43.5 million reads) per sample after quality control (Fig. 1a, b and Supplementary Data 1, 2). Of the total clean reads, 83.42–97.42% of reads were mapped to the…
Why Does Ion Torrent Still Exist??
An Ion Torrent DNA sequencer that is amazing and cool and full of rainbows and unicorns I’m sure many of you find yourselves at AGBT, if not Keith has an excellent post describing the experience. But I know, I know you’re bored. Of course you’re bored otherwise you wouldn’t be…
Detect minor clones in blood cells: St. Jude looks deep to find source of accelerated aging in childhood cancer survivors
“We found a specific chemotherapeutic signature associated with survivors of Hodgkin lymphoma,” said co-corresponding author John Easton, Ph.D., St. Jude Department of Computational Biology. “In these survivors, we determined that T-cell clonal hematopoiesis is associated with mutations in the major signaling protein STAT3.” The researchers determined that the drug procarbazine, a…
WGCNA TOM calculation time
WGCNA TOM calculation time 0 I am currently working on co-expression analysis for a data set of around 60,000 genes and running the job on server. I am currently waiting to complete TOM calculation (matrix multiplication BLAS) as it already taken few days and still running. If anyone have any…
Addgene: pX459-sgRNA2-2-RPB1-C-term Sequences
> Addgene Partial NGS Result GAGGGCCTATTTCCCATGATTCCTTCATATTTGCATATACGATACAAGGCTGTTAGAGAGATAATTGGAA TTAATTTGACTGTAAACACAAAGATATTAGTACAAAATACGTGACGTAGAAAGTAATAATTTCTTGGGTA GTTTGCAGTTTTAAAATTATGTTTTAAAATGGACTATCATATGCTTACCGTAACTTGAAAGTATTTCGAT TTCTTGGCTTTATATATCTTGTGGAAAGGACGAAACACCGTGGGGTGCGGCAGCGGGCTAGTTTTAGAGC TAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGCTTTT TTGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTTTTAGCGCGTGCGCCAATTCTGCA GACAAATGGCTCTAGAGGTACCCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGA CCCCCGCCCATTGACGTCAATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTA CGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATG ACGGTAAATGGCCCGCCTGGCATTGTGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACAT CTACGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTCTGCTTCACTCTCCCCATCTCC CCCCCCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGG GGGGGGGGGGGCGCGCGCCAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGCGGGGCGAGGCGGAGAGGTGC GGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCC TATAAAAAGCGAAGCGCGCGGCGGGCGGGAGTCGCTGCGACGCTGCCTTCGCCCCGTGCCCCGCTCCGCC GCCGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCC CTTCTCCTCCGGGCTGTAATTAGCTGAGCAAGAGGTAAGGGTTTAAGGGATGGTTGGTTGGTGGGGTATT AATGTTTAATTACCTGGAGCACCTGCCTGAAATCACTTTTTTTCAGGTTGGACCGGTGCCACCATGGACT ATAAGGACCACGACGGAGACTACAAGGATCATGATATTGATTACAAAGACGATGACGATAAGATGGCCCC AAAGAAGAAGCGGAAGGTCGGTATCCACGGAGTCCCAGCAGCCGACAAGAAGTACAGCATCGGCCTGGAC ATCGGCACCAACTCTGTGGGCTGGGCCGTGATCACCGACGAGTACAAGGTGCCCAGCAAGAAATTCAAGG TGCTGGGCAACACCGACCGGCACAGCATCAAGAAGAACCTGATCGGAGCCCTGCTGTTCGACAGCGGCGA AACAGCCGAGGCCACCCGGCTGAAGAGAACCGCCAGAAGAAGATACACCAGACGGAAGAACCGGATCTGC TATCTGCAAGAGATCTTCAGCAACGAGATGGCCAAGGTGGACGACAGCTTCTTCCACAGACTGGAAGAGT CCTTCCTGGTGGAAGAGGATAAGAAGCACGAGCGGCACCCCATCTTCGGCAACATCGTGGACGAGGTGGC CTACCACGAGAAGTACCCCACCATCTACCACCTGAGAAAGAAACTGGTGGACAGCACCGACAAGGCCGAC CTGCGGCTGATCTATCTGGCCCTGGCCCACATGATCAAGTTCCGGGGCCACTTCCTGATCGAGGGCGACC TGAACCCCGACAACAGCGACGTGGACAAGCTGTTCATCCAGCTGGTGCAGACCTACAACCAGCTGTTCGA GGAAAACCCCATCAACGCCAGCGGCGTGGACGCCAAGGCCATCCTGTCTGCCAGACTGAGCAAGAGCAGA CGGCTGGAAAATCTGATCGCCCAGCTGCCCGGCGAGAAGAAGAATGGCCTGTTCGGAAACCTGATTGCCC TGAGCCTGGGCCTGACCCCCAACTTCAAGAGCAACTTCGACCTGGCCGAGGATGCCAAACTGCAGCTGAG CAAGGACACCTACGACGACGACCTGGACAACCTGCTGGCCCAGATCGGCGACCAGTACGCCGACCTGTTT CTGGCCGCCAAGAACCTGTCCGACGCCATCCTGCTGAGCGACATCCTGAGAGTGAACACCGAGATCACCA AGGCCCCCCTGAGCGCCTCTATGATCAAGAGATACGACGAGCACCACCAGGACCTGACCCTGCTGAAAGC TCTCGTGCGGCAGCAGCTGCCTGAGAAGTACAAAGAGATTTTCTTCGACCAGAGCAAGAACGGCTACGCC GGCTACATTGACGGCGGAGCCAGCCAGGAAGAGTTCTACAAGTTCATCAAGCCCATCCTGGAAAAGATGG ACGGCACCGAGGAACTGCTCGTGAAGCTGAACAGAGAGGACCTGCTGCGGAAGCAGCGGACCTTCGACAA CGGCAGCATCCCCCACCAGATCCACCTGGGAGAGCTGCACGCCATTCTGCGGCGGCAGGAAGATTTTTAC CCATTCCTGAAGGACAACCGGGAAAAGATCGAGAAGATCCTGACCTTCCGCATCCCCTACTACGTGGGCC CTCTGGCCAGGGGAAACAGCAGATTCGCCTGGATGACCAGAAAGAGCGAGGAAACCATCACCCCCTGGAA CTTCGAGGAAGTGGTGGACAAGGGCGCTTCCGCCCAGAGCTTCATCGAGCGGATGACCAACTTCGATAAG AACCTGCCCAACGAGAAGGTGCTGCCCAAGCACAGCCTGCTGTACGAGTACTTCACCGTGTATAACGAGC TGACCAAAGTGAAATACGTGACCGAGGGAATGAGAAAGCCCGCCTTCCTGAGCGGCGAGCAGAAAAAGGC CATCGTGGACCTGCTGTTCAAGACCAACCGGAAAGTGACCGTGAAGCAGCTGAAAGAGGACTACTTCAAG AAAATCGAGTGCTTCGACTCCGTGGAAATCTCCGGCGTGGAAGATCGGTTCAACGCCTCCCTGGGCACAT…
scrnaseq – Cells with zero expression of a given gene
This has been debated for a few years now as the “dropout” problem, which is actually a mixture of different issues. On one hand, you are sequencing a relatively low input at a depth that does not reach saturation (i.e. you don’t measure all there is to measure). This is…
an international database of ncRNA sequences
Επιτομή The field of non-coding RNA biology has been hampered by the lack of availability of a comprehensive, up-to-date collection of accessioned RNA sequences. Here we present the first release of RNAcentral, a database that collates and integrates information from an international consortium of established RNA sequence databases. The initial…
(1): Explore the UCSC (U. California Santa Cruz)
(1): Explore the UCSC (U. California Santa Cruz) Genome Browser website GENOME DATA Question: Write a script to obtain all protein sequences coded in the human genome. Your output should be in the multiple FASTA format, which looks like: >ID1 Sequence 1… >ID2 Sequence 2… The ID field describes what…
Othram and Sorenson Forensics Partner to Develop a Unified Workflow for ISO17025-Accredited Forensic DNA Testing
THE WOODLANDS, Texas (PRWEB) February 08, 2023 Othram, the world’s first private laboratory purpose-built for forensic genetic genealogy (FGG), and Sorenson Forensics, a world-class ISO17025-accredited forensic laboratory, have announced a partnership to enable technology that provides law enforcement with the best chance to solve their case. Othram develops best-in-class…
cluster structures from Autodock runs
g_anadock(1) cluster structures from Autodock runs SYNOPSIS g_anadock -f eiwit.pdb -ox cluster.pdb -od edocked.xvg -of efree.xvg -g anadock.log -[no]h -[no]version -nice int -xvg enum -[no]free -[no]rms -cutoff real DESCRIPTION g_anadock analyses the results of an Autodock run and clusters the structures together, based on distance or RMSD. The docked energy…
Bioinformatics Team Lead, Plant Health at Greenlight Biosciences
ABOUT GREENLIGHT At GreenLight we are working to solve two of the world’s greatest problems: global food insecurity and equal access to vaccines and the associated health benefits. Unlike most corporations who can be required to put profits ahead of other principles, GreenLight is one of the first Public Benefit…
org.openapitools.codegen.SpecValidationException when using openapi-generator-maven-plugin for openapi version 3.1.0
I’m getting [ERROR] Error resolving ./paths/daas/res_prod_acptd_art_cnts.yaml java.net.URISyntaxException: Illegal character in opaque part at index 2, org.openapitools.codegen.SpecValidationException -Illegal character in opaque part at index 2 for the following yaml openapi: 3.1.0 info: title: test description: test # TODO: termsOfService field should be added later contact: name: test Support email: test version:…
Addgene: pX459-sgRNA2-CTCF-prom
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications. For your Materials & Methods section: pX459-sgRNA2-CTCF-prom was a gift from Job Dekker (Addgene plasmid # 195104…
The CRISPR/Cas9 syst…
The CRISPR/Cas9 system is made of Cas9 nuclease and single-guide RNA (sgRNA). The sgRNA is an engineered single RNA molecule containing crispr RNA and tracr RNA parts. The sgRNA recognizes the target sequence by standard Watson-Crick base pairing. It has to be followed by a DNA motif called a protospacer…
Institut Pasteur Project Aims to Index Global Sequencing Data
NEW YORK – The Institut Pasteur in Paris has won €2 million ($2.1 million) in EU funding to create a “search engine for DNA sequencing data,” indexing next-generation sequencing data available in the Sequence Read Archive in order to make it searchable and more accessible. The five-year IndexThePlanet project, led…
Postdoctoral Fellow in Bioinformatics, Center for Biomedical Informatics and Genomics job with Tulane University
Postdoctoral Fellow in Bioinformatics, Center for Biomedical Informatics and Genomics Location:New Orleans, LAOpen Date:May 15, 2022Description: The Tulane Center for Biomedical Informatics and Genomics is hiring a postdoc in bioinformatics. The main duties of the postdoc are to develop new algorithms, machine learning models, and software tools for mass spectrometry-based proteomics studies,…
Enolase-1 & prognosis & immune infiltration in breast cancer
Introduction Breast cancer is the most prevalent malignancy and the leading cause of cancer death in women worldwide.1 After its diagnosis, the most immediate challenge is to tailor treatment strategies and predict the prognosis; traditional clinicopathologic features, including estrogen receptor (ER), progesterone receptor (PR), human epidermal growth factor receptor 2…
Preoperative Cell-Free DNA (cfDNA) in Muscle-Invasive Bladder Cancer Treatment Outcome
Background: Tumor heterogeneity and lack of personalized prognosis leads to bladder cancer (BlCa) patients’ lifelong surveillance with invasive interventions, highlighting the need for modern minimally invasive tools for disease management. Herein, we have evaluated the clinical utility of preoperative serum cell-free DNA (cfDNA) in ameliorating patients’ risk-stratification and prognosis. Methods:…
gedmatch reddit – Iskanje Google
Piškotke in podatke uporabljamo za to: zagotavljanje in vzdrževanje Googlovih storitev; spremljanje izpadov delovanja in zaščito pred vsiljeno vsebino, prevarami in zlorabo; merjenje dejavnosti ciljnih skupin in statističnih podatkov glede spletnih mest zaradi razumevanja, kako se uporabljajo naše storitve, in izboljšanja kakovosti teh storitev. Če izberete »Sprejmi vse«, bomo piškotke…
Cannot download datasets files from Kaggle to Google Colab
def load_kaggle_csv(dataset_name, file_name): dataset_url = f”www.kaggle.com/{dataset_name}/download” !kaggle datasets download -d $dataset_url -f $file_name return pd.read_csv(file_name) dataset_name = “datasets/diegosilvadefrana/2023-data-scientists-jobs-descriptions” file_name = “Jobs.csv” FileNotFoundError Traceback (most recent call last) in 9 file_name = “Jobs.csv” 10 —> 11 df = load_kaggle_csv(dataset_name, file_name) 8 frames /usr/local/lib/python3.8/dist-packages/pandas/io/common.py in get_handle(path_or_buf, mode, encoding, compression, memory_map, is_text, errors,…
Head of Translational Research Bioinformatics job with F. Hoffmann-La Roche AG
The Position We are seeking a talented and highly motivated Sub-Chapter Lead for the Translational Research Bioinformatics team at the Director/Senior Director level. The team helps lead translational research efforts across the breadth of Roche Diagnostics portfolio including clinical chemistry, immunohistochemistry, tissue pathology, and molecular diagnostics. This position requires a…
Improve the bash code for picard analysis
Improve the bash code for picard analysis 0 HI, please help me to improve the following code of picard for multiple files. All .bam files are in the ~/path/file/mapped/ Code is given here #!/bin/bash #SBATCH –array=1-23 #SBATCH –ntasks=1 #SBATCH –cpus-per-task=6 #SBATCH –time=06:00:00 #SBATCH –mem-per-cpu=30G #SBATCH –job-name=1_23_duplicate #SBATCH –output=1_23_duplicate.%A_%a.out module load…
Illumina posts sales slump in Q4, bets on new sequencing machine to drive 2023 growth
Q4 Insights: Illumina, a global leader in DNA sequencing, reported a 10% drop in sales in the fourth quarter as growth at its Grail unit failed to offset a decline in the company’s core revenue. Core sequencing consumables revenue fell 13% in the fourth quarter even as Ilumina posted a growth in…
Complete Genomics Expands Its Family of Sequencing Platforms in America’s Markets
Credit: Complete Genomics Sponsored content brought to you by The use of sequencing continues to expand, as evidenced by the increase in the number of articles that mention sequencing. Indeed, according to PubMed.gov search results, this number doubled between 2000 and 2022. Along with this overall increase in using DNA…
Dissecting cell identity via network inference and in silico gene perturbation
CellOverview of the Oracle algorithm The CellOracle workflow is made up of several steps. We Tested and implemented CellOracle Python Versions 3.6 and 3.8 were developed and made available for use in the Jupyter Notepad environment CellOracle code can be downloaded open-source on GitHub.github.com/morris-lab/CellOracle), along with detailed descriptions of functions…
RNA-sequencing for diagnosing genetic disorders
RNA-sequencing can be used to improve the accuracy of diagnosing human genetic disorders, according to a recent press release from Pediatric Investigation. Diagnosing human genetic disorders has been simplified through the use of next-generation sequencing (NGS), with scientists capable of identifying diseases at the single gene level since the mapping…
NCBI search with ENTREZ biopython last refseq version tag
NCBI search with ENTREZ biopython last refseq version tag 0 Hi! I’m trying to deal with ncbi research and reproduce it in ENTREZ through biopython. This is my NCBI query : “Microbacterium”[Organism] AND “latest refseq”[filter] AND (all[filter] NOT partial[filter]) i then tried to reproduce it in biopython with : query…
Oppenheimer Says These 2 Stocks Have Double-Digit Gains in Sight
2023 is well underway now, and the key story is the sudden change in sentiment on the financial front. Last year’s bearish trend and headwinds are well known. Stubborn inflation, the Fed’s rapid increase in interest rates, the risk of recession, China’s shutdowns, and Russia’s Ukraine invasion; they all weighed…
Polygenic architecture of rare coding variation across 394,783 exomes
Sun, B. B. et al. Genetic associations of protein-coding variants in human disease. Nature 603, 95–102 (2022). ADS CAS Google Scholar Wang, Q. et al. Rare variant contribution to human disease in 281,104 UK Biobank exomes. Nature 597, 527–532 (2021). ADS CAS Google Scholar Backman, J. D. et al. Exome…
Values in a Affymetrix genome wide SNP Array call
To be sure: Values in a Affymetrix genome wide SNP Array call 0 Hello Everyone, I have a few simple questions because I am a bit confused. On a Genome-Wide Human SNP Array 6.0 there are SNPs and CNV-Probes which can be detected. For each SNP there are two strands…
Tophat2 manual pdf | Peatix
Tophat2 manual pdf Rna$ sequencing- data- analysis, – nsci- 580a3, – fall, -! linux_ x86_ 64/ tophat2. ln – s ~ / tophat- 2. qiagen, with its leading expertise in sample preparation technologies, has developed a complete portfolio of dedicated products to optimize your workflow – on any ngs instrument….
How to find the difference between old and current releases in UniprotKB
How to find the difference between old and current releases in UniprotKB 2 How to find the difference between old and current releases in UniprotKB. For specific entry id, what it has changed from previous releases to current releases. How we can check. previous UniprotKB current difference releases • 30…
Normalizing chip-seq signals with different number of peaks
Normalizing chip-seq signals with different number of peaks 0 Hello all, I want to compare chip-seq signals of polymerase1 and polymerase3 over few bed coordinates but I guess I must be normalizing these chip-seq data before doing any types of quantitative analysis. Polymerase1 chip-seq has lower signal to noise ratio….
R bug during normalize
R bug during normalize 0 Hello everyone, I am combining three different datasets together, and on the process to normalize the data, I encounter following errors. I am not sure how to solve the issue. I hope you guys could offer some suggestions. data.anchors_new <- FindIntegrationAnchors(object.list = object.list_new, normalization.method =…