Posted in Research

UniProtKB/SwissProt variant VAR_083726

 December 30, 2021

Sequence information
Variant position:  468
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:  805
The length of the canonical sequence.
Location on the sequence:  

GTLPFTYMLEKWRWMVFKGE

 I PKDQWMKKWWEMKREIVGVV

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GTLPFT--YMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVV

Mouse                         GTLPFT--YMLEKWRWMVFRGEIPKEQWMKKWWEMKREIVG

Rat                           GTLPFT--YMLEKWRWMVFQDKIPREQWTKKWWEMKREIVG

Bovine                        GTLPFT--YMLEKWRWMVFKGEIPKQQWMEKWWEMKREIVG

Cat                           GTLPFT--YMLEKWRWMVFKGEIPKEQWMQKWWEMKREIVG

Baker's yeast                 TDKSRDDRYAAGTFT--------PRTQLSPI-HKKRESVVS

Fission yeast                 -SAPYE--SCIVTKK--------PEPCIT---VKEEEQLAP
Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The “Sequence annotation in neighborhood” lines have a fixed format:

  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
Literature citations

Genetic variability of human angiotensin-converting enzyme 2 (hACE2) among various ethnic populations.

Li Q.; Cao Z.; Rahman P.;

Mol. Genet. Genomic Med. 0:0-0(2020)

Cited for: VARIANTS ARG-26; VAL-468; SER-638 AND ASP-720;

Disclaimer:

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.

Read more here: Source link