KEGG T30512: 12494


KEGG T30512: 12494


KEGG     T30512 (Metagenome): 12494
Entry
12494             CDS       T30512                                 
Name

pyruvate dehydrogenase subunit E1

  KO
Best hit
Taxonomy
Actinobacteria [GN:acq]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

C1137177:1..315

AA seq 105 aa
PESRGMLQLAANQQLDNLTFVINCNLQRLDGPVRGNGKIIQELEAFFKGAGWNVIKVIWG
RGWDQLLAADKDHALEHLMMETLDGDYQTFKANDGAYIREHFFGR

KEGG     T30512 (Metagenome): 2440
Entry
2440              CDS       T30512                                 
Symbol

aceE

Name

pyruvate dehydrogenase E1 component

  KO
Best hit
Taxonomy
Gammaproteobacteria – Others [GN:hin]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

SRS023987_Baylor_scaffold_2544:complement(317..976)

AA seq 219 aa
MQDGINRMYGEKQEDVFYYMTTLNEVMDQPAMPAGAEEGIRKGLYKFETVEGKKGKGQVQ
LLGSGAIMRHVREAAQILAKDYGVTSDVFSAPSFNELAREGHDAARWNLLHPTETQRVPY
VAQVLADLPTVASTDYVKAYADQIRAFVPSRHYHVLGTDGFGRSDSRANLREHFEVDARY
VVVAALSQLAKEGTVSNQVVADAIAKFGLNVDRINPLYA

KEGG     T30512 (Metagenome): 27343
Entry
27343             CDS       T30512                                 
Symbol

aceE

Name

pyruvate dehydrogenase E1 component

  KO
Best hit
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

C1168845:2..583

AA seq 194 aa
RPGQDNPAIQYMLKRREELGGFLPGRPNTQPEIQLPDDKVYAGTKKGSGKQLAASTMAFV
RLMKDLMRVKGFGHRIVPITPDEARTFGMDAFFPSAKLYNPNGQNYVPVDHELMLSYTES
PLGQILHVGINEAGATAAFIATGTSFDTHGEPMIPIYIFYSMFGFQRTGDAFWAAADQLA
RGFIIGATAGRTTL

KEGG     T30512 (Metagenome): 2441
Entry
2441              CDS       T30512                                 
Symbol

aceE

Name

pyruvate dehydrogenase E1 component

  KO
Best hit
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

SRS023987_Baylor_scaffold_2544:complement(979..1230)

AA seq 83 aa
AYYREAKDGQVLQEGINELGATASWLAAANSYSVNNQPMIPFFXXXXXXXVKVYNTKMAT
AIFKQVSFRTVSLTIHHLHLKLQ

KEGG     T30512 (Metagenome): 3990
Entry
3990              CDS       T30512                                 
Name

pyruvate dehydrogenase, decarboxylase component E1, thiamin-binding

  KO
Best hit
Taxonomy
Gammaproteobacteria – Others [GN:aap]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

SRS023987_Baylor_scaffold_4089:3..803

AA seq 266 aa
MFGFQRVGDLMWAAGDQLARGFMIGGTSGRTTLNGEGLQHEDGHSHIQSLVIPNCVSYDP
AYVYEVAVILQDGINRMYGEKQEDVFYYITTLNETYEQPAMPKGAEEGIRKGLYKFETVE
AKGNKGHVQLLGSGAIFRHVREAAQILANEYGVSSDVYSVPSFTEVAREGADAVRWNMLH
PTETPRVPYIAQVMNDAPAVAATDYMKLFAEQVXXXXXXXXEVDARYVVIAALHELAKQG
KFDAKVVADAIAKFGLKTEILNPLYA

KEGG     T30512 (Metagenome): 24763
Entry
24763             CDS       T30512                                 
Name

pyruvate dehydrogenase subunit E1

  KO
Best hit
Taxonomy
Actinobacteria [GN:acq]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

C1163751:1..492

AA seq 164 aa
YMLDRRRQLGGFIPERRDAGVELELPGDKTYDILKGGSGKQEVASTMAFVRLLKELIKDK
GIGRRIVPIVPDESRTFGLESLFPTKKIFNTQGQNYTPVDADMMLSYRESASGQLMHTGI
NEAGSVSLFQVAGTSYATHGEPMIPVYIFYSMFGFQRTGDQFWA

KEGG     T30512 (Metagenome): 26218
Entry
26218             CDS       T30512                                 
Symbol

aceE

Name

pyruvate dehydrogenase E1 component

  KO
Best hit
Taxonomy
Gammaproteobacteria – Others [GN:hin]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

C1166631:complement(2..538)

AA seq 179 aa
DPIETQDWLQSLDSLIREEGVERAQYIIEQVIGQARTNGVSLPTGVTTDYVNTIPASEQP
AYPGDHAIERRIRSAVRWNAIAMVLRSQKKDLDLGGHISTYQAAATMYEVCYNHFFKAST
EKNGGDLIFFQGHAAPGMYARAFLEGRLTEEQMDNFRQEAFTDGLSSYPHPKLMPEFWQ

KEGG     T30512 (Metagenome): 2186
Entry
2186              CDS       T30512                                 
Symbol

aceE

Name

pyruvate dehydrogenase E1 component

  KO
Best hit
Taxonomy
Gammaproteobacteria – Others [GN:aap]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

SRS023987_Baylor_scaffold_2272:3..302

AA seq 100 aa
VEGRITEDQMNNFRQECEPGKGLSSYPHPKLMPEFWQFSTVSMGLGPVNAIRSARFLKYL
DNRGLKDTKDQKVYAFLGDGEMDEIEAKGDLTFAAREGLD

KEGG     T30512 (Metagenome): 17507
Entry
17507             CDS       T30512                                 
Symbol

aceE

Name

pyruvate dehydrogenase E1 component

  KO
Best hit
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

C1148446:complement(3..359)

AA seq 119 aa
MDGHSPILASTNPAVKHYDPAYGYEIGHIVKRGLEQMYGNLDEDHDVMYYLTVYNEPIHQ
PAEPENLDVDGLLKGIYKLKDSELTSGPKTQLLASGVAVPWALEAQKLLAEDWGVSADV

KEGG     T30512 (Metagenome): 1244
Entry
1244              CDS       T30512                                 
Symbol

aceE

Name

pyruvate dehydrogenase E1 component

  KO
Best hit
Taxonomy
Gammaproteobacteria – Others [GN:aap]
Pathway
00010   Glycolysis / Gluconeogenesis
00020   Citrate cycle (TCA cycle)
00620   Pyruvate metabolism
01100   Metabolic pathways
01110   Biosynthesis of secondary metabolites
01120   Microbial metabolism in diverse environments
01200   Carbon metabolism
Other DBs
LinkDB
Position

SRS023987_Baylor_scaffold_1343:complement(2..1303)

AA seq 434 aa
VSEQPAYPGDKAIERRIRSAVRWNAIMAVLRGQKKDLELGGHISTYQSAASMYEVCFNHF
FKAATDKNGGDLVFFQGHAAPGMYARAFVEGRITEEQMNNFRQECEPGKGLSSYPHPKLM
PEFWQFSTVSMGLGPVNAIRTARFLKYLDNRGLKDTKDQKVYAFLGDGEMDEIEAKGDLT
FAAREGLDNLIFVVSCNLQRLDGPVTGNGKIVQELEGLFAGAGWEVIKVMWGSNWDKLFA
KDTSGKLTQLMMEVVDGDYLTFKSKDGAYVREHFFGRYPETAALVADMTDDEIWALRRGG
HDSEKLYAAFHKAQTXXXXXXXXLESLKSFRDHFQLDIKDEDIPNYPYITFPEGSEEYNY
LHGKRKALNGYLPKRLPKFTTEFKVPALEEFAPLLEEQARPISTTMAFVRFLNTLLKDKN
IGKQIVPIIADEAR

DBGET integrated database retrieval system

Read more here: Source link