Tag: AF

Acquisition of antibodies to Plasmodium falciparum and Plasmodium vivax antigens in pregnant women living in a low malaria transmission area of Brazil | Malaria Journal

WHO. World Malaria Report. Geneva: World Health Organization; 2019. Google Scholar  Rogerson SJ, Hviid L, Duffy PE, Leke RF, Taylor DW. Malaria in pregnancy: pathogenesis and immunity. Lancet Infect Dis. 2007;7:105–17. Article  CAS  PubMed  Google Scholar  Salanti A, Dahlback M, Turner L, Nielsen MA, Barfod L, Magistrado P, et al….

Continue Reading Acquisition of antibodies to Plasmodium falciparum and Plasmodium vivax antigens in pregnant women living in a low malaria transmission area of Brazil | Malaria Journal

Novel Agents Replace CAR T-Cell Therapy in Later-Line, Relapsed/Refractory DLBCL

New treatments are emerging for patients with relapsed/refractory diffuse large B-cell lymphoma in addition to chimeric antigen receptor T-cell therapy, which has moved up into the second line. New treatments are emerging for patients with relapsed/refractory diffuse large B-cell lymphoma (DLBCL) in addition to chimeric antigen receptor (CAR) T-cell therapy,…

Continue Reading Novel Agents Replace CAR T-Cell Therapy in Later-Line, Relapsed/Refractory DLBCL

cell Large Granular Lymphocytic Leukemia

Large granular lymphocyte leukemia (LGLL) is a rare chronic lymphoproliferative disorder originating in the mature T-cells and natural killer (NK) cells, accounting for 2% to 5% of all the chronic lymphoproliferative disorders in North America and Europe. T-cell LGLL (T-LGLL) is the most common subtype representing about 85% of LGLL…

Continue Reading cell Large Granular Lymphocytic Leukemia

Breadth of SARS-CoV-2 neutralization and protection induced by a nanoparticle vaccine

Animals and immunizations The study protocol and all veterinarian procedures were approved by the Bioqual IACUC per a memorandum of understanding with the Duke IACUC, and were performed based on standard operating procedures. Macaques studied were housed and maintained in an Association for Assessment and Accreditation of Laboratory Animal Care-accredited…

Continue Reading Breadth of SARS-CoV-2 neutralization and protection induced by a nanoparticle vaccine

What sequencing/alignment artifact is this?

What sequencing/alignment artifact is this? 0 I’m calling mitochondria variants with mutect2 and one variant looks like an artifact but I don’t understand what could be the cause. It looks like from IGV (picture below) that this variant is always at the same position on forward and backward reads. Also…

Continue Reading What sequencing/alignment artifact is this?

A causal association of ANKRD37 with human hippocampal volume

Lisman J, Buzsáki G, Eichenbaum H, Nadel L, Ranganath C, Redish AD. Viewpoints: how the hippocampus contributes to memory, navigation and cognition. Nat Neurosci. 2017;20:1434–47. CAS  PubMed  PubMed Central  Article  Google Scholar  Kim EJ, Pellman B, Kim JJ. Stress effects on the hippocampus: a critical review. Learn Mem. 2015;22:411–6. PubMed …

Continue Reading A causal association of ANKRD37 with human hippocampal volume

As of July 2015, the VCFtools project has been moved to github! Please visit the new website here: vcftools.github.io/man_0112a.html

NAME SYNOPSIS DESCRIPTION EXAMPLES BASIC OPTIONS SITE FILTERING OPTIONS INDIVIDUAL FILTERING OPTIONS GENOTYPE FILTERING OPTIONS OUTPUT OPTIONS COMPARISON OPTIONS AUTHOR NAME VCFtools v0.1.12a − Utilities for the variant call format (VCF) and binary variant call format (BCF) SYNOPSIS vcftools [ –vcf FILE | –gzvcf FILE | –bcf FILE]…

Continue Reading As of July 2015, the VCFtools project has been moved to github! Please visit the new website here: vcftools.github.io/man_0112a.html

Using RFLP-PCR, Mini Sequencing and STR Techniques in Preimplantation Diagnosis of Spinal Muscular Dystrophy in Vietnam

Background: Spinal Muscular Atrophy (SMA) is one of the most common autosomal recessive disorders in children after Duchenne muscular dystrophy affecting approximately 1 in 11,000 live births. There is no effective therapy for SMA; however, broadening our knowledge about the molecular genetics of the disease is resultant to develop potential…

Continue Reading Using RFLP-PCR, Mini Sequencing and STR Techniques in Preimplantation Diagnosis of Spinal Muscular Dystrophy in Vietnam

python – Matching two files(vcf to maf) using a dictionaries, and appending the contents

annotation_file ##INFO=<ID=ClinVar_CLNSIG,Number=.,xxx ##INFO=<ID=ClinVar_CLNREVSTAT,Number=.,yyy ##INFO=<ID=ClinVar_CLNDN,Number=.zzz #CHROM POS ID REF ALT QUAL FILTER INFO chr1 10145 . AAC A 101.83 . AC=2;AF=0.067;AN=30;aaa chr1 10146 . AC A 98.25 . AC=2;AF=0.083;AN=24;bbb chr1 10146 . AC * 79.25 . AC=2;AF=0.083;AN=24;ccc chr1 10439 . AC A 81.33 . AC=1;AF=0.008333;AN=120;ddd chr1 10450 . T G 53.09…

Continue Reading python – Matching two files(vcf to maf) using a dictionaries, and appending the contents

Blackrock Clinic launches new device to help combat AF

Electroporation systems being used to tackle a condition which one in four over-55s will develop THE Blackrock Clinic recently started its new program of electroporation for the treatment of patients with atrial fibrillation. Conventional catheter ablation for the treatment of cardiac arrhythmias uses tissue heating (radiofrequency current) to cauterize the…

Continue Reading Blackrock Clinic launches new device to help combat AF

Missing data per site

Hi, I want to calculate statistics of missing data per each site in my vcf file. Using vcftools –missing-site gives wrong stats for several sites. Is there is any other way to calculate it? Thank you! I have 36 samples and here is an example of the vcftools –missing-site output…

Continue Reading Missing data per site

Pangenome-based genome inference allows efficient and accurate genotyping across a wide spectrum of variant classes

Sequencing data We used publicly available sequencing data from the GIAB consortium45, 1000 Genomes Project high-coverage data46 and Human Genome Structural Variation Consortium (HGSVC)4. All datasets include only samples consented for public dissemination of the full genomes. Statistics and reproducibility For generating the assemblies, we used all 14 samples for…

Continue Reading Pangenome-based genome inference allows efficient and accurate genotyping across a wide spectrum of variant classes

Innovative site-specific anti-HER2 antibody-drug conjugate

Introduction Antibody-drug conjugates (ADCs) have been studied for decades as a promising cancer treatment. As compared to conventional chemotherapy, ADCs have a larger therapeutic window because of their ability to target antigen-expressing tumor cells.1 As ADC drug development technology continues to evolve, several ADC drugs are being introduced to the…

Continue Reading Innovative site-specific anti-HER2 antibody-drug conjugate

L-BFGS-B needs finite values of ‘fn’

Let me preface this with the admission that I am not an “expert” here by any means, which means I’m learning as I’m going. I have been tasked with the analysis of high dimensional (spectral) flow cytometry data with 32 parameters (time, six linear parameters (FSC and SSC) and 24…

Continue Reading L-BFGS-B needs finite values of ‘fn’

subpopulations available in MafH5.gnomAD.v3.1.1.GRCh38

subpopulations available in MafH5.gnomAD.v3.1.1.GRCh38 1 @b14a6f0d Last seen 16 hours ago United States Are subpopulation MAFs available for gnomADv.3.1.1 with any package, like they are in MafDb.gnomAD.r2.1.hs37d5? I’m trying to use Genomic Scores to obtain all variants in a genomic range with MAF in any subpopulation >= cutoff. I tried…

Continue Reading subpopulations available in MafH5.gnomAD.v3.1.1.GRCh38

Metagenomic data-analysis reveals enrichment of lipopolysaccharide synthesis in the gut microbiota of atrial fibrillation patients

This article was originally published here Zhonghua Xin Xue Guan Bing Za Zhi. 2022 Mar 24;50(3):249-256. doi: 10.3760/cma.j.cn112148-20210106-00015. ABSTRACT Objective: To investigate the functional changes of key gut microbiota (GM) that produce lipopolysaccharide (LPS) in atrial fibrillation (AF) patients and to explore their potential role in the pathogenesis of AF….

Continue Reading Metagenomic data-analysis reveals enrichment of lipopolysaccharide synthesis in the gut microbiota of atrial fibrillation patients

Phylogenomic analysis of Syngnathidae reveals novel relationships, origins of endemic diversity and variable diversification rates | BMC Biology

Stölting KN, Wilson AB. Male pregnancy in seahorses and pipefish: beyond the mammalian model. Bioessays. 2007;29:884–96. PubMed  Google Scholar  Whittington CM, Friesen CR. The evolution and physiology of male pregnancy in syngnathid fishes. Biol Rev Camb Philos Soc. 2020;95:1252–72. PubMed  Google Scholar  Rosenqvist G, Berglund A. Sexual signals and mating…

Continue Reading Phylogenomic analysis of Syngnathidae reveals novel relationships, origins of endemic diversity and variable diversification rates | BMC Biology

Gopal Addresses Differences Between Real-World and Clinical Trial Data for DLBCL

During a Targeted Oncology case-based roundtable event, Ajay K. Gopal, MD, discussed the options for second-line and subsequent treatment of a patient with relapsed/refractory diffuse large B-cell lymphoma who refuses CAR T-cell therapy. Targeted OncologyTM: What are the recommended approaches for relapsed/refractory DLBCL in the second-line and subsequent therapies settings?…

Continue Reading Gopal Addresses Differences Between Real-World and Clinical Trial Data for DLBCL

Mbedtls_ssl_handshake returned -0x7200 connecting to Amazon API gateway – Mbed TLS

Hello, I am trying to open a SSL connection to an AWS Cloudfront server from an ESP32 using mbedtls.The mbedtls_ssl_handshake function always returns -0x7200. From what I have seen this may be because the the buffer used to store TLS incoming fragment is to small but for me it is…

Continue Reading Mbedtls_ssl_handshake returned -0x7200 connecting to Amazon API gateway – Mbed TLS

vcf – Why does GATK produce both 0/1 and 1/0 genotypes in the same file? Are the two not equivalent?

I have always thought that 1/0 and 0/1 in VCF genotype fields are equivalent. And yet, GATK uses both. For example, these are two variants called in the same sample and the same run of GATK 4.1.4.0: chr7 117120317 . ATTCATTGTTTTGAAAGAAAGATGGAAGAATGAACTGAAG A 748.97 . AC=1;AF=0.5;AN=2;DP=64;ExcessHet=3.0103;FS=0;MLEAC=1;MLEAF=0.5;MQ=60;QD=11.89;SOR=7.223 GT:AD:DP:GQ:PL:SB 1/0:0,36:63:99:2294,1042,933:0,0,0,36 chr7 117120306 ….

Continue Reading vcf – Why does GATK produce both 0/1 and 1/0 genotypes in the same file? Are the two not equivalent?

Prediction of histone post-translational modification patterns based on nascent transcription data

Allfrey, V. G., Faulkner, R. & Mirsky, A. E. Acetylation and methylation of histones and their possible role in the regulation of RNA synthesis. Proc. Natl Acad. Sci. USA 51, 786–794 (1964). CAS  PubMed  PubMed Central  Google Scholar  Ho, J. W. K. et al. Comparative analysis of metazoan chromatin organization….

Continue Reading Prediction of histone post-translational modification patterns based on nascent transcription data

Accurate prediction of metagenome-assembled genome completeness by MAGISTA, a random forest model built on alignment-free intra-bin statistics | Environmental Microbiome

Steen AD, Crits-Christoph A, Carini P, DeAngelis KM, Fierer N, Lloyd KG, Cameron TJ. High proportions of bacteria and archaea across most biomes remain uncultured. ISME J. 2019;13:3126–30. PubMed  PubMed Central  Google Scholar  Goh KM, Shahar S, Chan K-G, Chong CS, Amran SI, Sani MH, Zakaria II, Kahar UM. Current…

Continue Reading Accurate prediction of metagenome-assembled genome completeness by MAGISTA, a random forest model built on alignment-free intra-bin statistics | Environmental Microbiome

EFFICACY AND SAFETY OF CYCLOPHOSPHAMIDE LOW-DOSE PRE-PHASE CHEMOTHERAPY IN DIFFUSE LARGE B CELL LYMPHOMA WITH GASTROINTESTINAL INVOLVEMENT

Luca Guarnera Hematology, Department of Biomedicine and Prevention, University Tor Vergara, Rome, Italy Federico Meconi Hematology, Department of Biomedicine and Prevention, University Tor Vergara, Rome, Italy Roberto Secchi Hematology, Department of Biomedicine and Prevention, University Tor Vergara, Rome, Italy Maria Rosaria Pascale Hematology, Department of Biomedicine and Prevention, University Tor…

Continue Reading EFFICACY AND SAFETY OF CYCLOPHOSPHAMIDE LOW-DOSE PRE-PHASE CHEMOTHERAPY IN DIFFUSE LARGE B CELL LYMPHOMA WITH GASTROINTESTINAL INVOLVEMENT

Notch activation suppresses endothelial cell migration and sprouting via miR-223-3p targeting Fbxw7

Alabi RO, Farber G, Blobel CP (2018) Intriguing roles for endothelial ADAM10/Notch signaling in the development of organ-specific vascular beds. Physiol Rev 98:2025–2061 CAS  Article  Google Scholar  Autiero M, De Smet F, Claes F, Carmeliet P (2005) Role of neural guidance signals in blood vessel navigation. Cardiovasc Res 65:629–638 CAS …

Continue Reading Notch activation suppresses endothelial cell migration and sprouting via miR-223-3p targeting Fbxw7

[slurm-users] mps on A100 only zero-index GPU was used when there is four GPUs

Hi threre, I was testing the MPS on Slurm19.05.5 with 4 A100 in compute node. In my opinion, the 4 A100 will be used.  But I found that only the first GPU was used. like below: the job script: #!/bin/bash #SBATCH -J date #SBATCH -p NVIDIAA100-PCIE-40GB #SBATCH -n 1 #SBATCH…

Continue Reading [slurm-users] mps on A100 only zero-index GPU was used when there is four GPUs

A pilot study of the use of dynamic cfDNA from aqueous humor and vitreous fluid for the diagnosis and treatment monitoring of vitreoretinal lymphomas

The diagnosis of vitreoretinal lymphoma (VRL), a rare subtype of primary central nervous system lymphoma (PCNSL), is challenging. We aimed to investigate the mutational landscape of VRL by sequencing circulating tumor DNA (ctDNA) from aqueous humor (AH) and/or vitreous fluid (VF), as well as the application of ctDNA sequencing to…

Continue Reading A pilot study of the use of dynamic cfDNA from aqueous humor and vitreous fluid for the diagnosis and treatment monitoring of vitreoretinal lymphomas

Ensembl VEP gnomAD annotated allele frequencies different from gnomAD browser

I’ve annotated some variants using VEP, and was looking at the minor allele frequencies. Some of the variants had very different MAFs in the annotation than I expected (I expected MAF < 1%, whereas some annotated MAFs were >50%). I looked up the same variants on the gnomAD v3 browser,…

Continue Reading Ensembl VEP gnomAD annotated allele frequencies different from gnomAD browser

The Genetic Architecture of Sleep Health Scores in the UK

Introduction Sleep is a complex neurological and physiological state. It is defined as a natural and reversible state of reduced responsiveness to external stimuli and relative inactivity, accompanied by a loss of consciousness.1 Sleep disorders can be classified as seven major categories: insomnia disorders, sleep-related breathing disorders, central disorders of…

Continue Reading The Genetic Architecture of Sleep Health Scores in the UK

Identification of differentially expressed genes in AF

Defeng Pan,1,&ast; Yufei Zhou,2,&ast; Shengjue Xiao,1,&ast; Yue Hu,3,&ast; Chunyan Huan,1 Qi Wu,1 Xiaotong Wang,1 Qinyuan Pan,1 Jie Liu,1 Hong Zhu1 1Department of Cardiology, The Affiliated Hospital of Xuzhou Medical University, Xuzhou, Jiangsu, 221004, People’s Republic of China; 2Department of Cardiology, Shanghai Institute of Cardiovascular Diseases, Zhongshan Hospital and Institutes of…

Continue Reading Identification of differentially expressed genes in AF

Toll-like receptor 2/4 in Chinese patients with sepsis

Introduction Sepsis is a life-threatening organ dysfunction that results from an exaggerated host immune response to disseminate infection.1 Despite improvements in treatment strategies, sepsis remains a leading cause of death in critically ill patients worldwide.2 Low platelet number, known as thrombocytopenia, is common in infectious diseases (also sometimes referred to…

Continue Reading Toll-like receptor 2/4 in Chinese patients with sepsis

bedtools intersect error: Invalid record in file

Hello to all I am trying to run bedtools intersect with vcf file and a bed file (my goal is to add the depth data to my VCF) I get an error running this command: bedtools intersect -a depth.bed -b fish.vcf -wa -wb > $out The error: “Error: Invalid record…

Continue Reading bedtools intersect error: Invalid record in file

Brem Looks at Multiple Treatments for Patients With DLBCL

During a Targeted OncologyTM Case-Based Roundtable event, Elizabeth A. Brem, MD, an assistant professor in Division of Hematology/Oncology, Department of Medicine at UC Irvine Health in Los Angeles, CA, moderated a discussion about a 43-year-old woman with diffuse large B-cell lymphoma. Targeted Oncology™: What therapeutic options would you consider at…

Continue Reading Brem Looks at Multiple Treatments for Patients With DLBCL

GATK GenotypeGVCFs changes HET to REF_ALT

Dear all, I’ve been using GATK HaplotypeCaller / GenotypGVFs (v4.2.3.0) for a while but, recently found something strange. There is a position (7063) with 8 reads (3T + 5A) that, even though HaplotyCaller calls as a HET (see image, lower track): NC_046966.1 7063 . T A,<NON_REF> 177.64 . BaseQRankSum=0.887;DP=8;ExcessHet=3.0103;MLEAC=1,0;MLEAF=0.500,0.00;MQRankSum=2.369;RAW_MQandDP=16885,8;ReadPosRankSum=1.345 GT:AD:DP:GQ:PL:SB…

Continue Reading GATK GenotypeGVCFs changes HET to REF_ALT

Systems biology analysis of human genomes points to key pathways conferring spina bifida risk

Significance Genetic investigations of most structural birth defects, including spina bifida (SB), congenital heart disease, and craniofacial anomalies, have been underpowered for genome-wide association studies because of their rarity, genetic heterogeneity, incomplete penetrance, and environmental influences. Our systems biology strategy to investigate SB predisposition controls for population stratification and avoids…

Continue Reading Systems biology analysis of human genomes points to key pathways conferring spina bifida risk

Biomolecules | Free Full-Text | AlphaFold-Predicted Structures of KCTD Proteins Unravel Previously Undetected Relationships among the Members of the Family

One of the most striking features of KCTD proteins is their involvement in apparently unrelated yet fundamental physio-pathological processes. Unfortunately, comprehensive structure–function relationships for this protein family have been hampered by the scarcity of the structural data available. This scenario is rapidly changing due to the release of the protein…

Continue Reading Biomolecules | Free Full-Text | AlphaFold-Predicted Structures of KCTD Proteins Unravel Previously Undetected Relationships among the Members of the Family

how to add reference alleles to VCF?

how to add reference alleles to VCF? 1 I’m converting gVCFs to VCF, but the reference alleles are missing. An example below: #CHROM POS ID REF ALT QUAL FILTER INFO FORMAT 180525_FD02929177 1 97547947 . T . . . DP=31 GT:DP:RGQ 0/0:31:81 1 97915614 . C . . . DP=40…

Continue Reading how to add reference alleles to VCF?

Why invariant blocks in GATK consistently have very low quality scores (but not variant sites)

I am using the latest GATK 4.1.2.0 to do variant calling on insect samples with a reference genome of a closely related species. The heterozygosity is approximately 0.02. I followed the standard pipeline of “HaplotypeCaller –> GenomicDBImport –> GenotypeGVCFs” to get my unfiltered VCFs, however, although my variant sites have…

Continue Reading Why invariant blocks in GATK consistently have very low quality scores (but not variant sites)

No quality in non-variant sites GATK

No quality in non-variant sites GATK 1 Heys, I am doing the SNP calling with Haplotypecaller BP_Resolution, CombineGVCFs with convert-to-base-pair-resolution and GenotypeGVCFs with include-non-variant-sites with GATK and when I get my vcf file, the non-variant sites does not have any quality at all: #CHROM POS ID REF ALT QUAL FILTER…

Continue Reading No quality in non-variant sites GATK

I can’t get a dossage file using PLINK

Hi, I have been trying to get a dosage file from vcf, map and fam files. For that, I have written this bash script : plink –fam plink.fam –map plink.map –dosage one.vcf –write-dosage However, I got this error: –dosage: Reading from one.vcf. Error: Line 1 of one.vcf has fewer tokens…

Continue Reading I can’t get a dossage file using PLINK

protti source: R/fetch_alphafold_prediction.R

#’ Fetch AlphaFold prediction #’ #’ Fetches atom level data for AlphaFold predictions either for selected proteins or whole #’ organisms. #’ #’ @param uniprot_ids optional, a character vector of UniProt identifiers for which predictions #’ should be fetched. This argument is mutually exclusive to the code{organism_name} argument. #’ @param…

Continue Reading protti source: R/fetch_alphafold_prediction.R

gnomAD v3 link not working for download

gnomAD v3 link not working for download 1 your URL is wrong. $ wget -q -O – “https://storage.googleapis.com/gcp-public-data–gnomad/release/3.1.1/vcf/genomes/gnomad.genomes.v3.1.1.sites.chr1.vcf.bgz” | gunzip -c | head ##fileformat=VCFv4.2 ##hailversion=0.2.64-1ef70187dc78 ##FILTER=<ID=AC0,Description=”Allele count is zero after filtering out low-confidence genotypes (GQ < 20; DP < 10; and AB < 0.2 for het calls)”> ##FILTER=<ID=AS_VQSR,Description=”Failed VQSR filtering…

Continue Reading gnomAD v3 link not working for download

plotting roh from bcftools

plotting roh from bcftools 0 Heys, I am following this small tutorial on how to calculate ROHs from a vcf file using bcftools (samtools.github.io/bcftools/howtos/roh-calling.html) and I am getting this txt file: # This file was produced by: bcftools roh(1.10.2+htslib-1.10.2-3) # The command line was: bcftools roh -G30 –AF-dflt 0.4 my_file.vcf…

Continue Reading plotting roh from bcftools

Interpreting output of BCFtools RoH

Interpreting output of BCFtools RoH 0 Hello! I am using BCFtools RoH for the first time, and I am having some trouble understanding its output file. The input is a gvcf file with genotype calls for one sample only, and I want to infer where there might be autozygous tracts….

Continue Reading Interpreting output of BCFtools RoH

Open multi-file AlphaFold models | ChimeraX Recipes

# # Open AlphaFold database models for proteins larger than 1400 amino acids. # These calculated in 1400 amino acid segments every 200 amino acids due to # limitations (GPU memory) of the AlphaFold software. We load and align # the segment models. This produces many clashes. # # Opening…

Continue Reading Open multi-file AlphaFold models | ChimeraX Recipes

alphafold colab github

for the third time worked! Found inside – Page iiThe eight-volume set comprising LNCS volumes 9905-9912 constitutes the refereed proceedings of the 14th European Conference on Computer Vision, ECCV 2016, held in Amsterdam, The Netherlands, in October 2016. Please make sure you have a large enough hard drive space, bandwidth…

Continue Reading alphafold colab github

missing genotype ./. even with many reads under AD and DP

missing genotype ./. even with many reads under AD and DP 0 Hi All, I am trying to troubleshoot all the missing genotypes in my VCF. I don’t quite understand why I get missing genotypes (./.) when there are plenty of reads under AD and DP. I think it’s because…

Continue Reading missing genotype ./. even with many reads under AD and DP

probable dimethyladenosine transferase-like, maker-scaffold153_size302544-snap-gene-2.18 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of probable dimethyladenosine transferase-like vs. L. salmonis genes Match: EMLSAG00000006273 (supercontig:LSalAtl2s:LSalAtl2s341:673186:674124:1 gene:EMLSAG00000006273 transcript:EMLSAT00000006273 description:”augustus_masked-LSalAtl2s341-processed-gene-6.3″) HSP 1 Score: 484.567 bits (1246), Expect = 2.083e-174Identity = 227/310 (73.23%), Postives = 259/310 (83.55%), Query Frame = 0 Query: 9 KVRKTGSGMSTVEAAGSGGGGQQGMVFNTGLGQHILKNPLVVQSIIDKAALRSTDVVLEIGPGTGNLTVRALEKCKKLIACEVDPRMVAELQKRVQGTHFQSKLQIMVGDVIKTDLPFFDACVANVPYQISSPLVFKLLLHRPFFRCAVLMFQREFAQRLVAKPGDKLYCRLSINTQLLARVDHVMKVGKGNFRPPPKVESSVVRIEPRNPPPPINFKEWDGLTRVAFVRKNKTLGAAFNQTTVLMMLEKNYRVHLSLADEPVPEKIDIKSIIETVLAEIAFKEKRARSMDIDDFMKLLHAFNAKGIHFV 318 KV+ T + GG+QG+VFNT LGQHILKNP VV…

Continue Reading probable dimethyladenosine transferase-like, maker-scaffold153_size302544-snap-gene-2.18 (gene) Tigriopus kingsejongensis

Annotate Structural variants with population specific allele frequency values

Annotate Structural variants with population specific allele frequency values 0 Hi, Has anyone tried filtering structural variants based on pupulation specific allele frequency (AF) values (for example gnomAD-SV or phase 3 1000 genome SV)? I have a set of SVs that I detected using a multipronged approach. For prioritising variants,…

Continue Reading Annotate Structural variants with population specific allele frequency values

Comparative genomic analysis of Methanimicrococcus blatticola provides insights into host adaptation in archaea and the evolution of methanogenesis

1. Hackstein JH, Stumm CK. Methane production in terrestrial arthropods. Proc Natl Acad Sci USA. 1994;91:5441–5. CAS  PubMed  PubMed Central  Article  Google Scholar  2. Hackstein JHP, van Alen TA. Fecal methanogens and vertebrate evolution. Evolution. 1996;50:559–72. PubMed  Article  PubMed Central  Google Scholar  3. Borrel G, McCann A, Deane J, Neto…

Continue Reading Comparative genomic analysis of Methanimicrococcus blatticola provides insights into host adaptation in archaea and the evolution of methanogenesis

2020 Heritable Human Genome Editing – Genômica

  editing methodologies. It is possible that continuing research may yield new methodologies that rapidly supersede the safety and efficacy of current editing approaches. Non-Heritable Genome Editing: The Use of Genome Editing in Somatic Cells One potential alternative to HHGE for the treatment of genetic dis- eases is somatic genome…

Continue Reading 2020 Heritable Human Genome Editing – Genômica

Nuclear protein in testis carcinoma

Introduction Nuclear protein in testis (NUT) carcinoma (NC) is defined by the rearrangement of the chromosomal region 15q14 harboring the NUTM1 gene. As a clinically aggressive neoplasm with poor differentiation, NC was previously believed to occur primarily in children and young adolescents. However, with an increasing number of reports, middle-aged…

Continue Reading Nuclear protein in testis carcinoma

Dealing with missing values in population allele frequency data in classifier model bulding context

Hi Stars, I would appreciate it if you share your inputs on the following issue: I am trying to make binary classifier models to classify variants into tow diffrent classes. The dataset is an annotated variant file with dimensions as 187,643 x 203. The first column contains class labels with…

Continue Reading Dealing with missing values in population allele frequency data in classifier model bulding context

Consolidate gVCF calling

Hi. I am running genotyping with HaplotypeCaller and GenotypeGVCFs. After that, in the genotype information for some samples in my vcf I found some calls containing multiple genotypes (e.g. 0|0:8,0:11:99:0|1:10777_AGGCGCGGAGG_A:102,126,462:). What could be the issue? Thank you! Here is the full line: chr10 10787 . G GGGCGCGCAGCGCCGGCGCA 356.99 PASS AC=1;AF=0.014;AN=18;BaseQRankSum=-1.762;DP=4023;Ex…

Continue Reading Consolidate gVCF calling

FreeBayes VCF output with FORMAT unknown

Hey, I am looking for a way to add samples ID names to the FORMAT in my vcf file. I have 10 sorted Bam files. I used Freebayes to create vcf files and my next step is merging all 10 files for VcfSampleCompare. And for that I need to define…

Continue Reading FreeBayes VCF output with FORMAT unknown

Inquiry related to vcf file and formatting

Hello everyone, I am trying to run predixcan software. But its showing error as segmentation fault implying that there is something wrong with my vcf files. I am sharing the header of vcf file. ##fileformat=VCFv4.1 ##INFO=<ID=LDAF,Number=1,Type=Float,Description=”MLE Allele Frequency Accounting for LD”> ##INFO=<ID=AVGPOST,Number=1,Type=Float,Description=”Average posterior probability from MaCH/Thunder”> ##INFO=<ID=RSQ,Number=1,Type=Float,Description=”Genotype imputation quality from…

Continue Reading Inquiry related to vcf file and formatting

print only columns with data from every line

print only columns with data from every line 0 Hi, I have a vcf file where is about 60 000 columns. Here is example of the first three lines: #CHROM POS ID REF ALT QUAL FILTER INFO FORMAT 10022-20416-17 10024-34469-18A 10025-34469-18B 10034-31625-18A 10035-31625-18B 10036-31625-18C 10042-29083-18 10044-34485-18A 10045-34485-18B 10046-34485-18C 10069-33802-18 10070-20895-17…

Continue Reading print only columns with data from every line

Allele frequency calculation

Allele frequency calculation 0 Hello everyone, I use vcf tools to find AF values by using this command: vcftools –gzvcf $SUBSET_VCF –freq2 –out $OUT –max-alleles 2 The output I got from this is: chr pos nalleles nchr a1 a2 <dbl> <dbl> <dbl> <dbl> <dbl> <dbl> 1 22 16050408 2 846…

Continue Reading Allele frequency calculation

plotting AF in vcf files

plotting AF in vcf files 0 Hello everyone, I want to plot AF distribution for all my vcf files. Is there any software to do that. I tried using vcfstats but its showing error in my vcf files. AF vcf plotting • 38 views Login before adding your answer. Source…

Continue Reading plotting AF in vcf files