Tag: bin

Slurm environment variable for requested time

For a slurm job, the environment variable $SLURM_JOB_NUM_NODES gives the number of nodes requested. Is there a similar variable that gives the run time requested? I couldn’t find the answer and I have tried $SLURM_JOB_TIME, $SLURM_TIME and $SLURM_SUBMIT_TIME, but none of these works. Ultimate goal is to let the script…

Continue Reading Slurm environment variable for requested time

How to fix deeptoolsintervals fatal error: python.h? ( Python, Python 3.X )

Problem : ( Scroll to solution ) I tried installing pip3 install deeptoolsintervals the error is: deeptoolsintervals/tree/tree.c:1:20: fatal error: Python.h: No such file or directory compilation terminated. error: command ‘/usr/bin/x86_64-linux-gnu-gcc’ failed with exit code 1 I have Ubuntu 16.04.7 and Python versions installed: ls /usr/bin | grep python dh_python2 dh_python3…

Continue Reading How to fix deeptoolsintervals fatal error: python.h? ( Python, Python 3.X )

Petabase-scale sequence alignment catalyses viral discovery

Serratus alignment architecture Serratus (v0.3.0) (github.com/ababaian/serratus) is an open-source cloud-infrastructure designed for ultra-high-throughput sequence alignment against a query sequence or pangenome (Extended Data Fig. 1). Serratus compute costs are dependent on search parameters (expanded discussion available: github.com/ababaian/serratus/wiki/pangenome_design). The nucleotide vertebrate viral pangenome search (bowtie2, database size: 79.8 MB) reached processing rates…

Continue Reading Petabase-scale sequence alignment catalyses viral discovery

bio-alignment from masyagin1998 – Github Help

Implementation of Needleman-Wunsch, Smith-Waterman, Hirschberg and affine bioinformatics algorithms for alighning biological sequences. Tech Algorithm is coded in pure C89 without any dependencies. Installation bio-alignment requires only C89-compatible compiler and make utility. $ cd bio-alignment $ make $ ./bin/bio-alignment –help $ ./bin/bio-alignment -i data/in.fasta -o out.fasta -s blosum62 -g -5…

Continue Reading bio-alignment from masyagin1998 – Github Help

Install CUDA on NVIDIA Jetson Nano

Hardware Pre-requisite Jetson Nano A 5V 4Ampere Charger 64GB SD card Software Preparing Your Raspberry Pi Flashing Jetson SD Card Image Unzip the SD card image Insert SD card into your system. Bring up Etcher tool and select the target SD card to which you want to flash the image….

Continue Reading Install CUDA on NVIDIA Jetson Nano

log repeats until it times out)

Your message dated Sat, 22 Jan 2022 21:52:05 +0100 with message-id <f98ce279-5828-d2b5-8b7c-88287a3ab…@debian.org> and subject line Re: Bug#997845: bug 997845 has caused the Debian Bug report #997845, regarding growlight: autopkgtest regression: log repeats until it times out to be marked as done. This means that you claim that the problem has…

Continue Reading log repeats until it times out)

H2O is an in-memory platform for distributed, scalable machine learning

H2O is an in-memory platform for distributed, scalable machine learning. H2O uses familiar interfaces like R, Python, Scala, Java, JSON and the Flow notebook/web interface, and works seamlessly with big data technologies like Hadoop and Spark. H2O provides implementations of many popular algorithms such as Generalized Linear Models (GLM), Gradient…

Continue Reading H2O is an in-memory platform for distributed, scalable machine learning

Gst-nvivafilter – Jetson AGX Xavier

Platforms: Jetson AGX Xavier Jetpack 4.5 Cuda 10.2 IMX274 camera Hi fellow developers, I am having difficulties at making custom CUDA implementation. I have succesfully run the below pipeline. gst-launch-1.0 nvarguscamerasrc ! ‘video/x-raw(memory:NVMM), width=(int)3840, height=(int)2160, format=(string)NV12, framerate=(fraction)60/1’ ! nvivafilter cuda-process=true customer-lib-name=”libnvsample_cudaprocess.so” ! ‘video/x-raw(memory:NVMM), format=(string)NV12’ ! nvvidconv ! nvegltransform ! nveglglessink…

Continue Reading Gst-nvivafilter – Jetson AGX Xavier

Cannot install Phyloseq and dada2

Hello all, I have been having issues installing packages that I really need to use. Basically, I cannot download either Phyloseq or dada2 and I believe it’s because I don’t have GenomeInfoDbData. But at the same time, I cannot install GenomeInfoDbData because I can’t seem to update the dependencies (“fansi”…

Continue Reading Cannot install Phyloseq and dada2

php-openapi make implementations of built-in interfaces PHP 8.1 friendly

Problem Unfortunately, PHP 8.1 throws Fatal Error if the built-in interface implementation is incompatible with the new, type enhanced interfaces. Example error: Fatal error: During inheritance of ArrayAccess: Uncaught Return type of cebeopenapispecResponses::offsetExists($offset) should either be compatible with ArrayAccess::offsetExists(mixed $offset): bool, or the #[ReturnTypeWillChange] attribute should be used to temporarily…

Continue Reading php-openapi make implementations of built-in interfaces PHP 8.1 friendly

[slurm-users] Strange sbatch error with 21.08.2&5

Running test job with srun works: wayneh@login:~$ srun -G16 -p v100 /home/wayne.hendricks/job.sh 179851 Linux dgx1-1 5.4.0-94-generic #106-Ubuntu SMP Thu Jan 6 23:58:14 UTC 2022 x86_64 x86_64 x86_64 GNU/Linux 179851 Linux dgx1-2 5.4.0-94-generic #106-Ubuntu SMP Thu Jan 6 23:58:14 UTC 2022 x86_64 x86_64 x86_64 GNU/Linux Submitting the same with sbatch does…

Continue Reading [slurm-users] Strange sbatch error with 21.08.2&5

Fail to install Ensembl VEP

Fail to install Ensembl VEP 2 Hello I have been encounter some issues on installing the Ensembl VEP. I am using Ubuntu 20.04 system, with the newest perl v5.34. perl -MBio::Root::Version -e ‘print $Bio::Root::Version::VERSION,”n”‘ 1.006924 However, when I install the VEP, it failed. Hello! This installer is configured to install…

Continue Reading Fail to install Ensembl VEP

error while loading shared libraries

Question: Question: bowtie2-align-s: error while loading shared libraries Abhinav26 days ago Question: bowtie2-align-s: error while loading shared libraries /home/emilyw/.conda/envs/shotgun_134/bin/bowtie2-align-s: error while loading shared libraries: libtbb.so.2: cannot open shared object file: No such file or directory (ERR): Description of arguments failed! Exiting…

Continue Reading error while loading shared libraries

Issue running MACS3

I am having issues running MACS3. I installed MACS3 using: wget github.com/macs3-project/MACS/archive/refs/tags/v3.0.0a6.tar.gz tar -xf v3.0.0a6.tar.gz chmod a+rwx MACS-3.0.0a6/bin/macs3 It appears to be installed correctly because the following code generates the predictd help window: MACS-3.0.0a6/bin/macs3 predictd –help However, when I try running the actual code I get the following error: MACS-3.0.0a6/bin/macs3…

Continue Reading Issue running MACS3

Description, Programming Languages, Similar Projects of Gpt 2 Pytorch

GPT2-Pytorch with Text-Generator Better Language Models and Their Implications Our model, called GPT-2 (a successor to GPT), was trained simply to predict the next word in 40GB of Internet text. Due to our concerns about malicious applications of the technology, we are not releasing the trained model. As an experiment…

Continue Reading Description, Programming Languages, Similar Projects of Gpt 2 Pytorch

Running Jobs on Titan

Running Jobs on Titan Table of Contents Titan’s Job Scheduler – SLURM Documentation Translating to SLURM commands from other workload managers Basic SLURM Commands squeue sinfo scontrol sbatch scancel Titan’s Environment Module System – LMOD Listing all available modules on Titan Loading a module into your environment Listing all modules…

Continue Reading Running Jobs on Titan

Bug#1002849: marked as done (python3-sage: missing Breaks+Replaces: sagemath-common (

Your message dated Sat, 08 Jan 2022 14:36:33 +0000 with message-id <e1n6cpd-0006a9…@fasolo.debian.org> and subject line Bug#1002849: fixed in sagemath 9.4-3 has caused the Debian Bug report #1002849, regarding python3-sage: missing Breaks+Replaces: sagemath-common (<< 9.4) to be marked as done. This means that you claim that the problem has been dealt…

Continue Reading Bug#1002849: marked as done (python3-sage: missing Breaks+Replaces: sagemath-common (

make Pyspark working inside jupyterhub

You need to configure the pyspark kernel. On my server jupyter kernels are located at: /usr/local/share/jupyter/kernels/ You can create a new kernel by making a new directory: mkdir /usr/local/share/jupyter/kernels/pyspark Then create the kernel.json file – I paste my as a reference: { “display_name”: “pySpark (Spark 1.6.0)”, “language”: “python”, “argv”: […

Continue Reading make Pyspark working inside jupyterhub

How to build mbedtls for arm gcc

I want to use mbedtls for my stm32 projects, but I have some problems with building. I have to build mbedtls with arm-none-gcc compiler, right? My command is :(in build directory). CC=/home/jareeeeczek/Arczbit/Firmware/ProgramingRelated/ARM_GCC/gcc-arm-none-eabi-10-2020-q4-major/bin/arm-none-eabi-gcc CFLAGS=’-fstack-protector-strong’ cmake -DUSE_SHARED_MBEDTLS_LIBRARY=On ../ and I have error while compiling test program: none-eabi-10-2020-q4-major/bin/arm-none-eabi-gcc CFLAGS=’-fstack-protector-strong’ cmake – DUSE_SHARED_MBEDTLS_LIBRARY=On ../…

Continue Reading How to build mbedtls for arm gcc

runing a command multiple times in different nodes in SLURM

I want to run three instances of GROMACS mdrun on three different nodes. I have three temperatures 200,220 and 240 K and I want to run 200 K simulation on node 1, 220 K simulation on node 2 and 240 K simulation on node 3. I need to do all…

Continue Reading runing a command multiple times in different nodes in SLURM

processing in strelka2 with multiples bam file in directory

processing in strelka2 with multiples bam file in directory 0 If I manually tell strelka2 to use these three bam files below, then I get the desired results of 3 individually genome files in results/variants. xxx_00.bam yyy_01.bam zzz_02.bam ${path_to_strelka}/bin/configureStrelkaGermlineWorkflow.py –bam xxx_00.bam –bam yyy_01.bam –bam zzz_02 –referenceFasta <fasta> –callRegions <.bed.gz> –runDir…

Continue Reading processing in strelka2 with multiples bam file in directory

Processed: src:pktanon: fails to migrate to testing for too long: autopkgtest regression on armhf

Processing control commands: > close -1 2~git20160407.0.2bde4f2+dfsg-8 Bug #1003104 [src:pktanon] src:pktanon: fails to migrate to testing for too long: autopkgtest regression on armhf Marked as fixed in versions pktanon/2~git20160407.0.2bde4f2+dfsg-8. Bug #1003104 [src:pktanon] src:pktanon: fails to migrate to testing for too long: autopkgtest regression on armhf Marked Bug as done >…

Continue Reading Processed: src:pktanon: fails to migrate to testing for too long: autopkgtest regression on armhf

Lammps in wsl – LAMMPS Installation

after making ubuntu in windows and installing the prerequisite commands ( sudo apt install -y cmake build-essential ccache gfortran openmpi-bin libopenmpi-dev libfftw3-dev libjpeg-dev libpng-dev python3-dev python3-pip python3-virtualenv libblas-dev liblapack-dev libhdf5-serial-dev hdf5-tool)I downloadedLAMMPS Patch Release 14 Dec 2021 From www.lammps.org/download.htmland after extracting, I put it on the desktop. Next I entered…

Continue Reading Lammps in wsl – LAMMPS Installation

LAMMPS fix print function – Stack Overflow

First of all, I’m very new to LAMMPS so I’m sorry if my question is trivial.I’m trying to model a gas of atoms that float in a square box, they obey an NVE integration and only feel a shifted Lennard-Jones potential, no other interaction is introduced. What I’m trying to…

Continue Reading LAMMPS fix print function – Stack Overflow

Kaggle-titanic – A tutorial for Kaggle’s Titanic: Machine Learning from Disaster competition. Demonstrates basic data munging, analysis, and visualization techniques. Shows examples of supervised machine learning techniques.

Kaggle-titanic This is a tutorial in an IPython Notebook for the Kaggle competition, Titanic Machine Learning From Disaster. The goal of this repository is to provide an example of a competitive analysis for those interested in getting into the field of data analytics or using python for Kaggle’s Data Science…

Continue Reading Kaggle-titanic – A tutorial for Kaggle’s Titanic: Machine Learning from Disaster competition. Demonstrates basic data munging, analysis, and visualization techniques. Shows examples of supervised machine learning techniques.

Sod1 integrates oxygen availability to redox regulate NADPH production and the thiol redoxome

Significance Cu/Zn superoxide dismutase (Sod1) is a key antioxidant enzyme, and its importance is underscored by the fact that its ablation in cell and animal models results in oxidative stress; metabolic defects; and reductions in cell proliferation, viability, and lifespan. Curiously, Sod1 detoxifies superoxide radicals (O2•−) in a manner that…

Continue Reading Sod1 integrates oxygen availability to redox regulate NADPH production and the thiol redoxome

Rapid In Vivo Fixation and Isolation of Translational Complexes from Eukaryotic Cells

The workflow consists of growing cells in strictly controlled environmental conditions, rapidly chilling them using melting water/ice and fixing with pre-optimized concentration of formaldehyde and incubation time. The fixation reaction is then quenched using excess of primary amino group-containing compounds, such as glycine or tryps. Cells are collected, washed and…

Continue Reading Rapid In Vivo Fixation and Isolation of Translational Complexes from Eukaryotic Cells

MCScanX: not found – githubmate

Hi CJ-Chen, Thanks for developing this tool. I having an issue when I try to use Quick Run MCScanX Wrapper. error log here: [Debug…All Standard Error Info will show as following:…] Curr log file:/tmp/TBtools.14595798488989250861.20210723103734.log Curr java version:11.0.11 Curr TBtools version:1.09854 Maxmum Memory for Curr TBtools: 4162846720 curVersion:1.09854:force Fetch Location:200 Factor:0.1516546094367225…

Continue Reading MCScanX: not found – githubmate

China Paper Sharing | SEU/TJU: circRNA is a gene therapy target for RCC Manufacturer and Supplier

  Basic information Title: ciRS-7 is a prognostic biomarker and potential gene therapy target for renal cell carcinoma   Journal: Molecular Cancer     Impact factor: 27.401   Vazyme products:   HiScript® III 1st Strand cDNA Synthesis Kit (+gDNA wiper)(number: Vazyme #R312, for 1st Strand cDNA Synthesis) AceQ® qPCR SYBR Green Master Mix (High ROX Premixed)(number: Vazyme…

Continue Reading China Paper Sharing | SEU/TJU: circRNA is a gene therapy target for RCC Manufacturer and Supplier

docx files fail to open in RStudio on Debian (at least 11) – Java rstudio

System details RStudio Edition : Dektop RStudio Version : 1.4.1717 and 2021.09.0+350 OS Version : Debian 11 R Version : 4.0.4 Steps to reproduce the problem Knit an R Markdown file to Word format. The file should be created. However, it’s not automatically opened. Click on the file in the…

Continue Reading docx files fail to open in RStudio on Debian (at least 11) – Java rstudio

How does slurm work? – IT & Software development Q&A

Hi, I was relatively recently told about slurm, however, as usual, I did not have time to go into details and had to quickly write scripts and subsample them “to not waste time”. Well, since recently, constantly goes out of timeout and scripts “do not finish” as simply not enough…

Continue Reading How does slurm work? – IT & Software development Q&A

Error in Authenticator.pre_spawn_start: CalledProcessError Command – jupyterhub

Hello all, I am new to JupyterHub and trying to integrate it with LTI as an authenticator. We have our own course provider platform like edX and Canvas so we are doing custom configuration in the jupyterhub_config.py. However, I am partially successful in doing so because when I launch my…

Continue Reading Error in Authenticator.pre_spawn_start: CalledProcessError Command – jupyterhub

python – How to implement Bayesian Inference correctly with pymc3?

I have been working with pymc3 for a while and I was observing the several tutorials with examples. However, I am not sure if I am approaching the Bayesian InFerence method correctly. Find below my approach: from pymc3.distributions import Interpolated import numpy as np # import warnings # import sys…

Continue Reading python – How to implement Bayesian Inference correctly with pymc3?

A Fast, Memory-Efficient, and Accurate Mechanism to Find Fuzzy Seed Matches

BLEND is a mechanism that can efficiently find fuzzy seed matches between sequences to significantly improve the performance and accuracy while reducing the memory space usage of two important applications: 1) finding overlapping reads and 2) read mapping. Finding fuzzy seed matches enable BLEND to find both 1) exact-matching seeds…

Continue Reading A Fast, Memory-Efficient, and Accurate Mechanism to Find Fuzzy Seed Matches

main-armv7-default][science/cp2k-data] Failed for cp2k-data-7.1.0 in stage

You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: y…@freebsd.org Log URL: beefy12.nyi.freebsd.org/data/main-armv7-default/p772274a15b8b_s0630a06b2a/logs/cp2k-data-7.1.0.log Build URL: beefy12.nyi.freebsd.org/build.html?mastername=main-armv7-default&build=p772274a15b8b_s0630a06b2a Log: =>> Building science/cp2k-data build started at Sun Dec 19…

Continue Reading main-armv7-default][science/cp2k-data] Failed for cp2k-data-7.1.0 in stage

Install Slurm 19.05 on a standalone machine running Ubuntu 20.04

Use apt to install the necessary packages: sudo apt install -y slurm-wlm slurm-wlm-doc Load file:///usr/share/doc/slurm-wlm/html/configurator.html in a browser (or on WSL2), and: 1. Set your machine’s hostname in `SlurmctldHost` and `NodeName`. 2. Set `CPUs` as appropriate, and optionally `Sockets`, `CoresPerSocket`, and `ThreadsPerCore`. Use command `lscpu` to find what you…

Continue Reading Install Slurm 19.05 on a standalone machine running Ubuntu 20.04

docker – SLURM cluster inside k8s cannot run srun command

I’m a beginner k8s user, I’m trying to recreate this docker-compose SLURM cluster with kubernetes. First I converted the docker-compose.yaml file into k8s yaml file in order to use kubectl apply -f . to create pods and services. I’m using minikube on my computer with the none driver (like this…

Continue Reading docker – SLURM cluster inside k8s cannot run srun command

Blast command line pipeline not working

Blast command line pipeline not working 0 Hello, I am running now a local blast pipeline using MacOs. The goal here is to take interval of the 5 best hits and then extract the SNP variants from multiple vcf.gz files. But I am facing an error which I cannot solve….

Continue Reading Blast command line pipeline not working

Failing to install VEP dependencies

Failing to install VEP dependencies 0 I’m trying to install VEP, but am getting stuck installing its dependencies. I try to install as suggested here www.ensembl.org/info/docs/tools/vep/script/index.html cd ~/bin git clone github.com/Ensembl/ensembl-vep.git cd ensembl-vep perl INSTALL.pl But I get this error: ERROR: DBI module not found. VEP requires the DBI perl…

Continue Reading Failing to install VEP dependencies

Error with file guillaumeKUnitigsAtLeast32bases_all.fasta, kUnitigLengths.txt is of size 0, must be at least of size 1.

Hello, I am trying running an assembly with MaSuRCa but am getting an error at the step: “Computing super reads from PE”. here’s the output with the error: [xxxx@vic Bovidae]$ cd Assembly_test/ [xxxx@vic Assembly_test]$ ls assemble.sh guillaumeKUnitigsAtLeast32bases_all.fasta.tmp masurca_assembly.o4302352 meanAndStdevByPrefix.pe.txt pe_data.tmp quorum_mer_db.jf work1 environment.sh guillaumeKUnitigsAtLeast32bases_all.jump.fasta masurca_config.txt pe.cor.fa pe.renamed.fastq super1.err ESTIMATED_GENOME_SIZE.txt masurca_assembly.e4302352…

Continue Reading Error with file guillaumeKUnitigsAtLeast32bases_all.fasta, kUnitigLengths.txt is of size 0, must be at least of size 1.

FTBFS on riscv64, linked with -lpthread instead of -pthread

Package: fastp Version: 0.23.2+dfsg-1 Severity: normal Tags: ftbfs upstream patch User: debian-ri…@lists.debian.org Usertags: riscv64 Dear maintainer, fastp currently fails to build from source on riscv64: | g++ ./obj/adaptertrimmer.o ./obj/basecorrector.o ./obj/duplicate.o ./obj/evaluator.o ./obj/fastareader.o ./obj/fastqreader.o ./obj/filter.o ./obj/filterresult.o ./obj/htmlreporter.o ./obj/jsonreporter.o ./obj/main.o ./obj/nucleotidetree.o ./obj/options.o ./obj/overlapanalysis.o ./obj/peprocessor.o ./obj/polyx.o ./obj/processor.o ./obj/read.o ./obj/readpool.o ./obj/seprocessor.o ./obj/sequence.o ./obj/stats.o ./obj/threadconfig.o…

Continue Reading FTBFS on riscv64, linked with -lpthread instead of -pthread

[moiexpositoalonsolab/grenepipe] freebayes causes early error about number of threads

Hi Lucas, got a weird one for you. If I change the caller from hapotypecaller to freebayes, I get the error below. It’s doubly strange because it seems to occur well before freebayes would be used in the pipeline. [Sat Dec 11 11:13:02 2021] rule samtools_stats: input: dedup/111D03-1.bam output: qc/samtools-stats/111D03-1.txt…

Continue Reading [moiexpositoalonsolab/grenepipe] freebayes causes early error about number of threads

Generating Multiple Species Alignment Of Novel Transcripts For Phylocsf

Short version: How would you go about generating multiple species alignments of novel transcripts from bos taurus (assembly UMD3.1) with human/mouse/dog for use with PhyloCSF? Context and what I’ve tried so far: Through a sequencing experiment, our lab has identified a large set of new transcripts in Bos taurus. We…

Continue Reading Generating Multiple Species Alignment Of Novel Transcripts For Phylocsf

PyTorch model conversion – Technical Support

I’m unable to convert a model in pytorch This is the script to download the pretrained weights import torch import torchvision.models as models resnet18 = models.resnet18(pretrained=True) torch.save(resnet18, ‘resnet18.pt’) This is the script for converting ./convert –model-name resnet18 –platform pytorch –model resnet18.pt –input-size-list ‘3,224,224’ –mean-values ‘103.94,116.78,123.68,58.82’ –quantized-dtype asymmetric_affine –kboard VIM3 –print-level…

Continue Reading PyTorch model conversion – Technical Support

JupyterHub & IRkernel misbehaving — next steps for debugging? – JupyterHub

I am trying to get an R kernel working in Jupyterhub — it was working on an Ubuntu 16.04 install but it stopped when I upgraded to 20.04 and did a fresh install of everything (default proxy and processor setups; no docker complexities; installed through pip). I followed the instructions…

Continue Reading JupyterHub & IRkernel misbehaving — next steps for debugging? – JupyterHub

NoMachine Forums – NoMachine and slurm created cgroups

Hello everyone, We installed NoMachine on clusters we use remotely. These clusters are handled with a scheduler called slurm. Every time a user allocate a node with slurm, its session enters a cgroup which bounds the resources the user can use. Slurm allows for example one user to use a…

Continue Reading NoMachine Forums – NoMachine and slurm created cgroups

How to call LOH with FreeC

How to call LOH with FreeC 0 Good morning, I am try to infer loss of heterozygosity (LOH) from WGS data using Freec. For this purpose, I am using these parameters in the “[BAF]” section of the configuration file: [BAF] makePileup = My_somaticVCF.vcf.gz fastaFile = hg19.fa SNPfile = hg19_snp142.SingleDiNucl.1based.txt.gz When…

Continue Reading How to call LOH with FreeC

How can the R location be customized for RStudio

How can the R location be customized for RStudio I previously used homebrew to install R and the package installer for RStudio. Recently I started using Boxen, which takes over homebrew. I had to re-install R from source using homebrew, and it now exists in my Boxen Cellar location. Now…

Continue Reading How can the R location be customized for RStudio

multiBamSummary for unpaired end read?

Hello everyone, I am using multiBamSummary to computes read coverages for many bam files. multiBamSummary bins –bamfiles *.bam -out readCounts.npz –outRawCounts readCounts.tab However, I got errors as below. May I get help please?? [E::bgzf_read] Read block operation failed with error 2 after 0 of 4 bytes Traceback (most recent call…

Continue Reading multiBamSummary for unpaired end read?

Is there a way to get RNAFold output for multifasta in tabular format?

Is there a way to get RNAFold output for multifasta in tabular format? 1 I am trying to calculate the MFE along with the secondary structure for multifasta using RNAFold. The output generated is of the format. >abc GGCGGAGGUAGGGAGGCACGCGAUGGUAUUUCAGAGCCUCCCGAAUACAACUCCAGGGUAGGGUGUUGAAAGCGUUGGAGAUGUCUAAAGACACCGCCAG (((((…..(((((((.(..((…….)).).)))))))……..((((((.((…………)).)))))).((((….))))))))).. (-35.80) >lmn GGGAGGCACGCGAUGGUAUUUCAGAGCCUCCCGAAUACAACUCCAGGGUAGGGUGUUGAAAGCGUUGGAGAUGUCUAAAGACACCGCCAGUACCACCCCA (((((((.(..((…….)).).)))))))………….((((..((((………((((.(.((((….)))).).)))))))))))).. (-29.30) >xyz CGAUGGUAUUUCAGAGCCUCCCGAAUACAACUCCAGGGUAGGGUGUUGAAAGCGUUGGAGAUGUCUAAAGACACCGCCAGUACCACCCCACCCCGGGACA ….(((……..)))(((((…………((((.(((((.((……((((.(.((((….)))).).)))))).))))).))))))))).. (-28.40) Is…

Continue Reading Is there a way to get RNAFold output for multifasta in tabular format?

Running SortMeRNA on Multiple Files

Running SortMeRNA on Multiple Files 0 Hi all, I am VERY new to SortMeRNA (I’m a PhD student taking a bioinformatics class that has been very poorly taught). I have 27 paired samples for a total of 54 samples named like this: SRR13711719_1_val_1.fq SRR13711719_2_val_2.fq. So the format is _1_val_1.fq and…

Continue Reading Running SortMeRNA on Multiple Files

Install pytorch in jetson nano

install pytorch in jetson nano Done! Getting Started with Jetson Nano In this tutorial, you will learn how to set up the NVIDIA ® Jetson ™ Nano and install everything you need to use the full power of the tiny embedded board. Git – Version Contol…

Continue Reading Install pytorch in jetson nano

main-arm64-default][devel/RStudio] Failed for RStudio-2021.09.1+372 in build

You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: y…@freebsd.org Log URL: ampere2.nyi.freebsd.org/data/main-arm64-default/p7539e33f88ff_s169b368a62/logs/RStudio-2021.09.1+372.log Build URL: ampere2.nyi.freebsd.org/build.html?mastername=main-arm64-default&build=p7539e33f88ff_s169b368a62 Log: =>> Building devel/RStudio build started at Wed Dec 8…

Continue Reading main-arm64-default][devel/RStudio] Failed for RStudio-2021.09.1+372 in build

bash script not a valid identifier

bash script not a valid identifier 2 I am trying to run bash script, but it gives this error ( `$fastq’: not a valid identifier). #!/bin/bash database=”kraken2_database” fastq=”fastq_dir” for $fastq in $(ls *_R1.fastq.gz | sed ‘s/_R1.fastq.gz//’) do kraken2 –db $database –threads 8 –memory-mapping –use-names –confidence 0.1 –report taxonomy_reads/${fastq}_kraken2.tax –paired ${fastq}_R1.fastq.gz…

Continue Reading bash script not a valid identifier

Can’t install scikit-learn in Python

Hi I’m trying to install scikit-learn in Python on a mac, but failed. Does anyone having idea how to fix this? Thanks! The error message is as follows. Error message Command /usr/bin/python -c “import setuptools, tokenize;file=’/private/tmp/pip_build_root/scikit-learn/setup.py’;exec(compile(getattr(tokenize, ‘open’, open)(file).read().replace(‘ ‘, ‘ ‘), file, ‘exec’))” install –record /tmp/pip-UfI2WG-record/install-record.txt –single-version-externally-managed –compile failed with…

Continue Reading Can’t install scikit-learn in Python

query sequence is input sequence or its reverse complement

query sequence is input sequence or its reverse complement 0 >sp|O14920.1|IKKB_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase subunit beta; Short=I-kappa-B-kinase beta; Short=IKK-B; Short=IKK-beta; Short=IkBKB; AltName: Full=I-kappa-B kinase 2; Short=IKK2; AltName: Full=Nuclear factor NF-kappa-B inhibitor kinase beta; Short=NFKBIKB; AltName: Full=Serine/threonine protein kinase IKBKB MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT LAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLM LMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED QELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSI…

Continue Reading query sequence is input sequence or its reverse complement

Parallel genomic responses to historical climate change and high elevation in East Asian songbirds

Extreme environments present profound physiological stress. The adaptation of closely related species to these environments is likely to invoke congruent genetic responses resulting in similar physiological and/or morphological adaptations, a process termed “parallel evolution” (1). Existing evidence shows that parallel evolution is more common at the phenotypic level than at…

Continue Reading Parallel genomic responses to historical climate change and high elevation in East Asian songbirds

find positions of a short sequence in a genome

Here’s a demo Python script you can modify for your use, which suggests the rough principle: #!/usr/bin/env python import sys import re bed = “””chr1t0t10tABCDEFGHIJ chr1t5t15tFGHIJABCDO chr1t10t20tABCDOPABCD””” string_to_match = sys.argv[1] pattern = re.compile(string_to_match) for line in bed.split(“n”): (chr, start, stop, id) = line.split(“t”) for match in pattern.finditer(id): sys.stdout.write(“t”.join([chr, str(int(start) +…

Continue Reading find positions of a short sequence in a genome

Socat not found in the /usr/bin folder in MacOS

Socat not found in the /usr/bin folder in MacOS 0 I have installed socat using brew install socat on my Mac and then tried to connect to the cluster. But it does not connect. It throws the following error message: zsh:1: no such file or directory: /usr/bin/socat kex_exchange_identification: Connection closed…

Continue Reading Socat not found in the /usr/bin folder in MacOS

Why are my Nextflow processes not executing in parallel?

I have written a Nextflow script with three process: The first process takes a pair of fastq files and aligns with reference genome. The process writes the resulting SAM file into sam channel. Second process takes input from the sam channel and creates a BAM file from it, and writes…

Continue Reading Why are my Nextflow processes not executing in parallel?

Count 5’End Mapped To A Specific Genomic Position

Count 5’End Mapped To A Specific Genomic Position 7 I got several SAM/BAM files, and I am interested in 5’ends of the mapped reads. Is there any tools or scripts to count how many 5’ends are mapped at a specific genomic position? N.B. I am not try to count the…

Continue Reading Count 5’End Mapped To A Specific Genomic Position

Quick questions about Alevin and AlevinQC

I have just started using Alevin and I have few basic queries. And I am asking this because I couldn’t find it in the documentation How to know how many reads are uniquely mapping and how many are multi mapping when doing quantification with Alevin. The alevin_meta_info.json says Number of…

Continue Reading Quick questions about Alevin and AlevinQC

GEMINI ISSUE

Using gemini found at: /usr/local/bin/gemini /usr/local/share/gemini/anaconda/lib/python2.7/site-packages/gemini/config.py:61: YAMLLoadWarning: calling yaml.load() without Loader=… is deprecated, as the default Loader is unsafe. Please read msg.pyyaml.org/load for full details. config = yaml.load(in_handle) CADD scores are being loaded (to skip use:–skip-cadd). GERP per bp is being loaded (to skip use:–skip-gerp-bp). Traceback (most recent call last):…

Continue Reading GEMINI ISSUE

Epistasis shapes the fitness landscape of an allosteric specificity switch

Computational design Protein modeling and design was performed with Rosetta version 3.5 (2015.19.57819)35,37. Python and shell scripts for generating input from Rosetta and analyzing from Rosetta are available at: github.com/raman-lab/biosensor_design The high-resolution TtgR structure co-crystalized with tetracycline was selected as the starting point for computational design (PDB: 2UXH)28. The structure…

Continue Reading Epistasis shapes the fitness landscape of an allosteric specificity switch

Full-Stack DevOps Developer position at EMBL Grenoble

*F**ull-Stack DevOps Developer position at EMBL Grenoble* EMBL Grenoble is looking for a Full-Stack Software Developer to join the Crystallographic Information Management System (CRIMS) project. www.embl.org/jobs/position/GR00169 The Marquez Team operates the High Throughput Crystallization Laboratory (HTX Lab), one of the largest facilities of its kind in Europe and has developed…

Continue Reading Full-Stack DevOps Developer position at EMBL Grenoble

Leaderboard download fails if leaderboard only contains one page

kaggle competitions leaderboard –download lux-ai-2021  ✔  kaggle  Traceback (most recent call last): File “/usr/local/Caskroom/miniforge/base/envs/kaggle/bin/kaggle”, line 11, in <module> sys.exit(main()) File “/usr/local/Caskroom/miniforge/base/envs/kaggle/lib/python3.9/site-packages/kaggle/cli.py”, line 67, in main out = args.func(**command_args) File “/usr/local/Caskroom/miniforge/base/envs/kaggle/lib/python3.9/site-packages/kaggle/api/kaggle_api_extended.py”, line 831, in competition_leaderboard_cli self.competition_leaderboard_download(competition, path, quiet) File “/usr/local/Caskroom/miniforge/base/envs/kaggle/lib/python3.9/site-packages/kaggle/api/kaggle_api_extended.py”, line 784, in competition_leaderboard_download self.download_file(response, outfile, quiet) File…

Continue Reading Leaderboard download fails if leaderboard only contains one page

Unable to download fastq files in parallel / SOS

Unable to download fastq files in parallel / SOS 0 Hi! Very new to all this so bear with me if I’m using incorrect terminology. Also english is my second language. I’m trying to download my fastq files in parallel but it doesn’t work and I keep receiving this error:…

Continue Reading Unable to download fastq files in parallel / SOS

marked as done (gromacs build-depends on gcc-9)

Your message dated Sat, 18 Sep 2021 15:37:04 +0000 with message-id <e1mrcom-0000pb…@fasolo.debian.org> and subject line Bug#994290: fixed in gromacs 2021.3-3 has caused the Debian Bug report #994290, regarding gromacs build-depends on gcc-9 to be marked as done. This means that you claim that the problem has been dealt with. If…

Continue Reading marked as done (gromacs build-depends on gcc-9)

Shen Bin/Lou Xin team achieves efficient and accurate editing of zebrafish mitochondrial DNA

Mitochondrial diseases are a major genetic disease. The prevalence rate among newborns in the United States is about 1 in 5000. China currently lacks complete epidemiological data on mitochondrial diseases. At present, nearly 300 genes that cause mitochondrial diseases are known, including both mitochondrial DNA (mtDNA) coding and nuclear DNA…

Continue Reading Shen Bin/Lou Xin team achieves efficient and accurate editing of zebrafish mitochondrial DNA

Visulization of raw 4C-seq reads in UCSC

Visulization of raw 4C-seq reads in UCSC 1 I’m trying to create bedGraph files to view raw and normalised reads from a 4C-seq experiment to view in UCSC for two biological replicates. Is there a simple way to do this? I’ve tried using bamCoverage and expected to get peaks for…

Continue Reading Visulization of raw 4C-seq reads in UCSC

How to download BED file with all the fields?

How to download BED file with all the fields? 2 Hello, my goal : to download a certain BED file from ucsc website that contains all these fields: bin chrom chromStart chromEnd name score strand signalValue pValue qValue peak I will describe my actions and my problem: – I go…

Continue Reading How to download BED file with all the fields?

rosetta fold vs alphafold 2

S. Both AlphaFold and Xu use simple folding engines L-BFGS (L- Broyden–Fletcher–Goldfarb– Shanno (BFGS)) and CNS (Crystallography and NMR System), respectively, i.e., improvements come from a better energy potential using distributional information. The phase problem is a problem, to the point that in the past decade, several structures, such as M-PMV…

Continue Reading rosetta fold vs alphafold 2

SNP exon region UCSC

SNP exon region UCSC 2 how i can get SNP in only exons regions genome with UCSC? UCSC get the all SNP of gene region, and there is no filter option to get only exon region. tx ucsc SNP exon • 245 views • link updated 2 hours ago by…

Continue Reading SNP exon region UCSC

Difficulty installing Bioperl for use with GUIDANCE

Difficulty installing Bioperl for use with GUIDANCE 0 Hi, I am trying to use the Guidance software to analyze a set of 427 sequences. I have the software downloaded and installed the modules indicated in the Guidance user guide (Perl/BioPerl/Ruby), but when I attempt to run Guidance with the following…

Continue Reading Difficulty installing Bioperl for use with GUIDANCE

Script To Calculate Dinucleotide Frequency For Many Sequences

Hi, everyone, I need to calculate dinucleotide frequency for many sequences. As i know, the R command count(seq, 2, freq = TRUE) can calculate only one sequence. I am new in perl. Does anyone has reliable script to complete this task? I downloaded one script (shown below), but when running…

Continue Reading Script To Calculate Dinucleotide Frequency For Many Sequences

bash loop to python loop for google colabs

bash loop to python loop for google colabs 1 Hi there, I have a bash loop to use kallisto on my sequencing samples, but I’m trying now to run kb on google colabs (all the fastq files are on Google drive), so I’d appreciate a hand in ‘translating it to…

Continue Reading bash loop to python loop for google colabs

Remove related samples using plink

Remove related samples using plink 0 Hi, I generated pairwise IBD (PI_HAT) using plink1.9 –genome option. I have >200,000 samples, so I used –parallel and combined the sub files using cat. Is there a way to remove related samples using the output file .genome.gz ? I read about –rel-cutoff but…

Continue Reading Remove related samples using plink

Picard CalculateHsMetrics perTargetCoverage for Novaseq bams

Picard CalculateHsMetrics perTargetCoverage for Novaseq bams 0 Hello, I would like to use Picard’s CalculateHsMetrics to calculate per target coverage for Novaseq bam files. It seems that the tool is not able to calculate mean/normalized coverage for Novaseq bams but works well with Hiseq bams. Novaseq bams report quality scores…

Continue Reading Picard CalculateHsMetrics perTargetCoverage for Novaseq bams

miRDeep2.pl error in make_html2.pl

miRDeep2.pl error in make_html2.pl 0 I have installed cpan install PDF::API2 And still got error Can’t locate PDF/API2.pm in @INC (@INC contains: /home/nbri/Tikshana/Ath/small_RNA/mirDeep/mirdeep2/lib/perl5 /home/nbri/vaishali/TOMATO_SRNA/new_analysis/mirdeep2-master/lib/perl5 /usr/local/lib64/perl5 /usr/local/share/perl5 /usr/lib64 /perl5/vendor_perl /usr/share/perl5/vendor_perl /usr/lib64/perl5 /usr/share/perl5 .) at /home/nbri/Tikshana/Ath/small_RNA/mirDeep/mirdeep2/bin/make_html2.pl line 25. BEGIN failed–compilation aborted at /home/nbri/Tikshana/Ath/small_RNA/mirDeep/mirdeep2/bin/make_html2.pl line 25 locate PDF/API2.pm /home/nbri/.cpan/build/PDF-API2-2.041-0/blib/lib/PDF/API2.pm /home/nbri/.cpan/build/PDF-API2-2.041-0/lib/PDF/API2.pm /home/nbri/.cpan/build/PDF-API2-2.041-1/blib/lib/PDF/API2.pm /home/nbri/.cpan/build/PDF-API2-2.041-1/lib/PDF/API2.pm /home/nbri/.cpan/build/PDF-API2-2.041-2/blib/lib/PDF/API2.pm…

Continue Reading miRDeep2.pl error in make_html2.pl

Bash operations

Bash operations 3 How to write a bash script that receives ANY integer numbers and print their mean with 2 decimal digit accuracy? Bash • 592 views Here’s one such script: #!/usr/bin/env bash echo ${1} | awk -v RS=” ” ‘{ n++; s+=$0 } END { printf(“%.2fn”, s/n) }’ To…

Continue Reading Bash operations

Trimmomatic error: cannot execute binary file: Exec format error

Trimmomatic error: cannot execute binary file: Exec format error 1 I am trying to run Trimmomatic from a docker container using this piece of command: docker run -v ~:/home -v /data:/data quay.io/biocontainers/trimmomatic:0.36–6 trimmomatic PE -trimlog /usr/local/share/trimmomatic-0.36-6/adapters/NexteraPE-PE.fa:2:30:10 | /data/Sample1_R1.fastq.gz /data/Sample1_R2.fastq.gz | Sample1_R1_paired.fastq.gz Sample1_R1_unpaired.fastq.gz Sample1_R2_paired.fastq.gz Sample1_R2_unpaired.fastq.gz this is the error I recieve…

Continue Reading Trimmomatic error: cannot execute binary file: Exec format error

The day the world turned upside down

This newspaper’s headlines on this day 20 years ago spoke of a standard day in the news cycle for our journalists in Academy Street, Cork and Harcourt Street, Dublin.  Billions had been wiped off the value of Irish pensions in one of the market’s periodic slumps; Tipperary was celebrating the…

Continue Reading The day the world turned upside down

Performance assessment of DNA sequencing platforms in the ABRF Next-Generation Sequencing Study

. 2021 Sep;39(9):1129-1140. doi: 10.1038/s41587-021-01049-5. Epub 2021 Sep 9. Jonathan Foox  1   2 , Scott W Tighe  3 , Charles M Nicolet  4 , Justin M Zook  5 , Marta Byrska-Bishop  6 , Wayne E Clarke  6 , Michael M Khayat  7   8 , Medhat Mahmoud  7   8 , Phoebe K Laaguiby  3 , Zachary T…

Continue Reading Performance assessment of DNA sequencing platforms in the ABRF Next-Generation Sequencing Study

How to build and run a docker container with multiple conda envs – General Discussions

As a novice to this community (and technology) I have only a basic knowledge regarding how to build and deploy a docker so i was hoping someone could provide some help. The situation is the following: I wanna create a docker container with two conda environments and I wanna call…

Continue Reading How to build and run a docker container with multiple conda envs – General Discussions

Warning messages on Apple M1 BigSur

Warning messages on Apple M1 BigSur 0 @095e334e Last seen 4 hours ago Hong Kong Hi, Does bioconductor supports the binary of R created specifically for arm chips already ? I get the following warning when trying to install any Bioconductor packages: 1: In .inet_warning(msg) : unable to access index…

Continue Reading Warning messages on Apple M1 BigSur

Where can I get ?or how can I make a mappability track for hg38 assembly

Where can I get ?or how can I make a mappability track for hg38 assembly 2 Lucky you @manojmumar_bhosale I worked on similar problem recently and therefore have the bash script you can use. Required tools: GEM libary from here UCSC’s wigToBigWig from here (I chose binary for Linux 64…

Continue Reading Where can I get ?or how can I make a mappability track for hg38 assembly

Can’t run java in bash script : bioinformatics

I was trying to re-use one of my old scripts for trimmomatic but I was getting error “java: command not found”. I realised that it will work if the java command is first. It stops if there is anything above it, e.g This works: #!/bin/bash java –version PATH=/media/msz/Arabidopsis_project/scripts $ ./test.sh…

Continue Reading Can’t run java in bash script : bioinformatics

kaggle datasets for tableau

The homepage is full of small visualizations telling stories about each data set. This is the default Tableau location (if you’ve not changed) so far. Transformation processes can also be referred to as data wrangling, or data munging, transforming and mapping data from one raw data form into another format…

Continue Reading kaggle datasets for tableau

Blast locally on multiple fasta files with multiple database

Blast locally on multiple fasta files with multiple database 2 Hi all, I need to run blast locally on multiple fasta files contain in a directory. Previously, I have used command below: ls *.fasta | parallel -a – blastp -query {} -db my_database -evalue 0.00001 -qcov_hsp_perc 50 -outfmt 6 -max_target_seqs…

Continue Reading Blast locally on multiple fasta files with multiple database

No such file or directory when downloading DESeq2 package

error: cannot execute ‘f951’: execvp: No such file or directory when downloading DESeq2 package 0 @8e03f28b Last seen 4 hours ago United States When I download a package (DESeq2) from Bioconductor, I got the following error: gfortran: fatal error: cannot execute ‘f951’: execvp: No such file or directory compilation terminated….

Continue Reading No such file or directory when downloading DESeq2 package

GSTAr.pl probelm running

GSTAr.pl probelm running 0 Hi, I want to run CleaveLand to analyze my degradome sequencing, however, I run with the below error. The resulting file is empty and when I check the Checking Dependencies, it shows me GSTAr: FAIL. I always get this error even running with the tutorial files….

Continue Reading GSTAr.pl probelm running

Python FASTA scripting

Python FASTA scripting 4 Hi all, I finally got that illusive Bioinformatician job and am now undergoing training. My first project is to write a FASTA parsing script that will take a FASTA file and split it into multiple files each containing a gene and its sequence. The task is…

Continue Reading Python FASTA scripting

install GenomicFeatures fail

install GenomicFeatures fail 1 @5b9023e7 Last seen 19 hours ago China BiocManager::install(‘GenomicFeatures’) results show ‘getOption(“repos”)’ replaces Bioconductor standard repositories, see ‘?repositories’ for details replacement repositories: CRAN: mirrors.tuna.tsinghua.edu.cn/CRAN/ Bioconductor version 3.14 (BiocManager 1.30.16), R 4.1.0 (2021-05-18) Installing package(s) ‘GenomicFeatures’ also installing the dependencies ‘Rhtslib’, ‘Rsamtools’, ‘GenomicAlignments’, ‘rtracklayer’ Packages which are only…

Continue Reading install GenomicFeatures fail

phase_trio.sh | searchcode

phase_trio.sh | searchcode PageRenderTime 24ms CodeModel.GetById 16ms app.highlight 5ms RepoModel.GetById 1ms app.codeStats 0ms /Phase/phase_trio.sh github.com/BioinformaticsArchive/fCNV Shell |…

Continue Reading phase_trio.sh | searchcode

More than one archive specified. Try –help.

Package: routine-update Version: 0.0.6 Severity: important Hi Andreas, when working on making sure the python-biopython watch file was appropriately fixed, I saw routine-update choke with the following error: $ routine-update gbp:info: Fetching from default remote for each branch gbp:info: Branch ‘master’ is already up to date. gbp:info: Branch ‘pristine-tar’ is already up to date. gbp:info: Branch…

Continue Reading More than one archive specified. Try –help.

Snakemake-Aligment using BWA-MEM2

Hello I have started using snakemake 6.5.2 to align fastq files with reference file. I have pasted the error below in this question. How to allocate memory in the snakefile and read the header from samfile, ‘-‘. This is the snakefile (wrapper for running alignment): rule bwa_mem2_mem: input: reads=[“/scicore/home/cichon/GROUP/test_workflow/samples/{sample}.1.fq”, “/scicore/home/cichon/GROUP/test_workflow/samples/{sample}.2.fq”]…

Continue Reading Snakemake-Aligment using BWA-MEM2

Jury chosen for Carla Walker murder case in Tarrant County TX

Twelve Tarrant County residents were selected Thursday to judge whether or not a Fort Worth man is guilty of murdering a 17-year-old girl nearly 50 years ago. Jury selection in the trial of Glen McCurley took nearly all day Thursday. At about 4 p.m., the panel was selected who will…

Continue Reading Jury chosen for Carla Walker murder case in Tarrant County TX

lammps – KSpace style for hybrid/overlay table and dipole?

I’m trying to run lammps for a system subject to a custom short-range potential, that I have in a table, as well as the lammps lj/cut/dipole/long interaction (with LJ epsilon set to 0 because I do not want its contribution) with ewald summation. I need to provide a kspace_style for…

Continue Reading lammps – KSpace style for hybrid/overlay table and dipole?

Get chromosome sizes from fasta file

Get chromosome sizes from fasta file 4 Hello, I’m wondering whether there is a program that could calculate chromosome sizes from any fasta file? The idea is to generate a tab file like the one expected in bedtools genomecov for example. I know there’s the fetchChromSize program from UCSC, but…

Continue Reading Get chromosome sizes from fasta file