Tag: BLAST

Merlino, C. P. Bartolomeo Bizio’s letter to the most eminent priest, Angelo Bellani, concerning the phenomenon of the red-colored polenta [translated from the Italian]. J. Bacteriol. 9, 527–543 (1924). Grimont, P. A. D. & Dulong de Rosnay, H. L. C. Numerical study of 60 strains of Serratia. J. Gen. Microbiol….

Gengis Don & The Empire collide two musical worlds and leave their funky fingerprints on the music as the audience joins along a journey through the Hip Hop universe. Blast off in 3, 2, 1…described as the love child of Jazz & Boom Bap, Gengis Don has a sound of his own….

BLAST unmapped reads from BAM 0 Hey, I have sequenced a recombinant plasmid and I am trying to characterize the insert sequences that have not aligned to the reference. I have generated a BAM file with the unmapped sequences and now I am trying to BLAST these in various databases…

blast ring image generator PROBLEM 0 Good day or evening, in search of a working program for visualizing the complete genome, tried to use BRIG, but instead of the result we got (see fig1) nothing, some one now what the hell ?. I tried to compare 4 genomes of chlamydia…

Sampling the radiation To understand the phylogenetic relationships between Alpine whitefish, we carried out whole-genome resequencing on 96 previously collected whitefish (with associated phenotypic measurements including standard length and gill-raker counts; collected in accordance with permits issued by the cantons of Zurich (ZH128/15), Bern (BE68/15), and Lucerne (LU04/14); these fish…

Cui, B., Smooker, P. M., Rouch, D. A., Daley, A. J. & Deighton, M. A. Differences between two clinical Staphylococcus capitis subspecies as revealed by biofilm, antibiotic resistance, and pulsed-field gel electrophoresis profiling. J. Clin. Microbiol. 51, 9–14 (2013). CAS  PubMed  PubMed Central  Article  Google Scholar  Tevell, S., Hellmark, B.,…

How to replace underscore between digits and character or at second place (_) in protein seq header & discriptions 1 Hi, I want to remove(_) sign between the accession number and their description name like this -> ALKAOGAL_00001 Chromosomal_replication_initiator_protein_DnaA in all protein seq. Is there any script for this please…

Salje, J. Cells within cells: Rickettsiales and the obligate intracellular bacterial lifestyle. Nat. Rev. Microbiol. 19, 375–390 (2021). CAS  PubMed  Article  Google Scholar  Wang, S. & Luo, H. Dating Alphaproteobacteria evolution with eukaryotic fossils. Nat. Commun. 12, 3324 (2021). CAS  PubMed  PubMed Central  Article  Google Scholar  Strassert, J. F. H.,…

Mokomane M, Kasvosve I, Melo Ed, Pernica JM, Goldfarb DM. The global problem of childhood diarrhoeal diseases: emerging strategies in prevention and management. Ther Adv Infect Dis. 2018;5(1):29–43. PubMed  Google Scholar  Organization WH. Rotavirus vaccines: WHO position paper–July 2021. Weekly Epidemiol Rec. 2021;96(28):301–219. Google Scholar  Bucardo F, Reyes Y, Svensson…

Zaremba-Niedzwiedzka, K. et al. Asgard archaea illuminate the origin of eukaryotic cellular complexity. Nature 541, 353–358 (2017). CAS  PubMed  Article  Google Scholar  Williams, T. A., Cox, C. J., Foster, P. G., Szöllősi, G. J. & Embley, T. M. Phylogenomics provides robust support for a two-domains tree of life. Nat. Ecol….

Name Last modified Size Description Parent Directory   –   Aligned_Reads/ 2016-07-30 04:38 –   Cufflinks_Output/ 2017-11-11 11:53 –   FEELnc/ 2018-08-14 16:03 –   Gene_Expression/ 2016-09-01 14:14 –   Genome/ 2018-04-04 15:54 –   Intermediate_LncRNA.feelncclassifier.log 2016-08-05 15:59 18K   LncRNA/ 2018-08-08 11:07 –   Raw_Reads/ 2016-07-28 15:11 –  …

doi: 10.1016/j.fm.2022.104043. Epub 2022 Apr 23. Affiliations Expand Affiliations 1 Department of Food Science and Technology, The University of Georgia, 1109 Experiment Street, Griffin, GA, 30223-1797, USA. 2 Department of Food Science and Technology, The University of Georgia, 1109 Experiment Street, Griffin, GA, 30223-1797, USA. Electronic address: jchen@uga.edu. Item in…

Since 2010, there have been multiple new species added to the Listeria genus, many originally isolated from natural environments16. This paper describes the genotypic and phenotypic characterization of two new Listeria isolates obtained from soil samples collected in the Great Smoky Mountains National Park along the North Carolina-Tennessee border17. Evaluation…

BlastX through Biopython 0 I have an unknown gene segment in the Human_gene.txt file and I want to run blastx (translated nucleotide) using the blast module of Biopython by making the E-value threshold 0.0001 and displaying the match result of 50 residues of query and subject. I am trying this…

Article, 2014 In: Journal of Bioinformatics and Sequence Analysis, ISSN 2141-2464, Volume 6, 1, Pages 1-6, 2014 DOI:10.5897/ijbc2013.0086 Organisations Abstract Following advances in DNA and protein sequencing, the application of computational approaches in analysing biological data has become a very important aspect of biology. Evaluating similarities between biological sequences…

Hello everyone I have multiple short sequences of SARS-COV-2 in the range of 500-800 nucleotides, I need to blast them, I get a good result on BLAST-NCBI, but is there anyone here who uses AudacityInstant which belongs to GISAID, this site aligns only sequences higher than 10000 nucleotides, as you…

the FASTA format is not “officially” defined – even though it carries the majority of data information onliving systems. Its origins go back to asoftware tool calledFastawritten byDavidLipman(ascientist that later became, and still is, the director of NCBI) andWilliam R. Pearsonof the University ofVirginia. The tool itself has (to some…

BenchSci’s vision is to bring novel medicine to patients 50% faster by 2025. We’re achieving it by empowering scientists with the world’s most advanced biomedical artificial intelligence. Backed by F-Prime, Gradient Ventures (Google’s AI fund), and Inovia Capital, our platform accelerates science at 15 top-20 pharmaceutical companies and over 4,300…

What you are trying to do is fairly simple, and you are complicating it by: 1) not providing your sequences so that someone can reproduce your attempt; 2) giving a result in a form that is impossible to read. Be honest, can you make any sense of the result you…

Hey guys Self hit I have this actually a bit weird question about blast. I’ve been doing some work around single copy genome construction using Reciprocal best blast hit (RBBH) method. As I have something like 100+ annotated genome, I concatenated all annotated CDS into one fasta and makeblastdb with…

Conda recipes for the bioconda channel. 4571 Projects Similar to Bioconda Recipes Sequenceserver Intuitive local web frontend for the BLAST bioinformatics tool Homebrew Bio 🍺🔬 Bioinformatics formulae for the Homebrew package manager (macOS and Linux) Galaxy Data intensive science for everyone. Travel Guide “A travel guide to suggest activities you…

Provided by: libbio-perl-perl_1.7.2-2_all NAME Bio::Tools::Seg – parse “seg” output SYNOPSIS use Bio::Tools::Seg; my $parser = Bio::Tools::Seg->(-file => ‘seg.fasta’); while ( my $f = $parser->next_result ) { if ($f->score < 1.5) { print $f->location->to_FTstring, ” is low complexity\n”; } } DESCRIPTION “seg” identifies low-complexity regions on a protein sequence. It is…

Qiime2 Exclude Seqs with FASTQ as query data. 0 Hello, I am working with FASTQ files and I want to filter them based on the alignment with references sequences in FASTA format. I decided to use QIIME2 for this. So I imported both FASTA and FASTQ files to the required…

Eddykay310 Hi @cruizperez Please help me understand the problem here and how I can fix it. I have successfully generated my DBs but I get this error during analysis. The .dmnd files do not exist in the folders as the error says but I don’t know how I can generate…

Hi all, I’m trying to create a local nt blast database, my eventual goal is to create a subset based on a taxanomic group to be used on a cluster with limited storage space, its seems the only way to do this though is to start with the whole database…

Does anyone know? how to sort one16s rDNA from multiple 16s rDNA in one strains for phylogenetic tree construction? 3 Hi, i had extract 16srDNA sequence by using barrnap from complete genome of each strains. These are the output which are given below. Actually when i opened each strains file…

Share Tweet Share Share Email ClustalW is a computer tool of significant importance in bioinformatics. Primarily, biologists and statisticians used it for multiple sequence alignment. Many versions of ClustalW over the development of the algorithm are available now. How to perform a search on ClustalW? ClustalW homepage 1. Go to…

Introduction Escherichia coli is a common Gram-negative opportunistic pathogen that causes invasive host infections through virulence factors such as flagella, toxin secretion, and adhesins. According to the source of the infection, pathogenic E. coli can be classified as intestinal (diarrheagenic) and extraintestinal (ExPEC). Uropathogenic E. coli (UPEC) is the most…

In Chapter 2 we learned how to search databases with text queries. All of these were exact matches—that is, we were expecting to find the exact accession number or exactly spelled words. In this chapter, a much harder database-searching problem is introduced. How do you find matches when your query…

BLASTn using R 0 Hello, I have around 2000 DNA nucleotide sequences (60 bases long) stored in each row in an excel sheet. I want to run BLAST over each one of them individually and extract the “Description” of the first hit. Like for Example: Suppose on NCBI BLAST website…

Biopython NcbiblastpCommandline not working: “No such file or directory: ‘test.xml” 0 from Bio.Blast.Applications import NcbiblastpCommandline blastp=r”C:\NCBI\blast-BLAST_VERSION+\bin\blastp.exe” blastp_cline = NcbiblastpCommandline(blastp, query=r”C:/NCBI/blast-BLAST_VERSION+/bin/test.fasta”, db=r’C:/NCBI/blast-BLAST_VERSION+/bin/bos_protein.fasta’, outfmt=5, evalue=0.00001, out=r”C:/NCBI/blast-BLAST_VERSION+/bin/test.XML”) blastp_cline from Bio.Blast import NCBIXML with open(“test.XML”) as result_handle: E_VALUE_THRESH=0.01 blast_records = NCBIXML.parse(result_handle) blast_record = NCBIXML.read(result_handle) for alignment in blast_record.alignments: for hsp in alignment.hsps: if hsp.expect…

Methods The study was conducted at the Human Genetics Unit, Faculty of Medicine, University of Colombo. It was an experimental study, where a novel assay was designed for the targeted variant, and a cohort of hormone receptor positive breast cancer patients were genotyped for the CYP2D6*10 variant using the optimized…

Introduction The study of the microbial environments has benefited from the sequencing revolution, where technology improvement decreased the DNA sequencing cost and increased the number of sequenced nucleic bases. For approximately 20 years (depending on how we define the term metagenomics), it has allowed the decryption of the microbial composition…

How can I find genes located in the same region (overlapping) of the chromosome ? 1 I take the BAM file as input and perform RNA-Seq. The program prints out a list of genes to which the reads match. Some of the genes in the list overlapping in the same…

From scientific name to taxonomy information entrez 1 Hi all, I have a txt file with a list of scientific names of plants and I would like to obtain a final file with taxonomy information. For example, if one of my organism is Acalypha hispida, I would like to obtain…

Source: www.nature.com/articles/s41587-021-01179-w.epdf Proteins play an important part in the construction and function of all living organisms. Each protein is made up of a chain of amino acid building blocks. Much like an image might have numerous things, a protein can have multiple components, known as protein domains. Researchers have been…

Name Last modified Size Description Parent Directory   –   nextorf.py 2010-10-07 10:28 9.1K   test.fas 2010-10-07 10:28 517   testrp.fas 2010-10-07 10:28 50K   xbb_blast.py 2010-10-07 10:28 4.7K   xbb_blastbg.py 2010-10-07 10:28 2.3K   xbb_help.py 2010-10-07 10:28 2.2K   xbb_search.py 2010-10-07 10:28 5.0K   xbb_sequence.py 2010-10-07 10:28 399  …

Wu, W. et al. NDM metallo-β-lactamases and their bacterial producers in health care settings. Clin. Microbiol. Rev. 32, e00115–18 (2019). Yong, D. et al. Characterization of a new metallo-β-lactamase gene, bla NDM-1, and a novel erythromycin esterase gene carried on a unique genetic structure in Klebsiella pneumoniae sequence type 14…

We implemented a metagenomic DNA sequencing methodology to unbiasedly detect microbial species in CSF samples from patients with CNS symptoms in which a pathogen or EBV had been detected (Additional 3: Table 1). Samples positively identified with pathogen-specific quantitative PCR (qPCR), 16S rRNA gene sequencing or bacterial/mycotic culture in CSF…

DOI: 10.18129/B9.bioc.TAPseq     This package is for version 3.12 of Bioconductor; for the stable, up-to-date release version, see TAPseq. Targeted scRNA-seq primer design for TAP-seq Bioconductor version: 3.12 Design primers for targeted single-cell RNA-seq used by TAP-seq. Create sequence templates for target gene panels and design gene-specific primers using…

I’m trying to blastp multiple aminoacids sequences using biopython. I just can’t seem to get it right and i cant figure out the handbook for how to do this. I have come up with the following: open(“proteins_PROT.fasta”,”r”) from Bio.Blast.Applications import NcbiblastpCommandline cline = NcbiblastpCommandline(query=”proteins_PROT.fasta”, db=”nr”, evalue=0.001, remote=True, ungapped=True) NcbiblastpCommandline(cmd=’blastp’, query=”proteins_PROT.fasta”,…

Associated RNAi Experiments Homology BLAST of peroxisomal multifunctional enzyme type 2-like vs. L. salmonis genes Match: EMLSAG00000010112 (supercontig:LSalAtl2s:LSalAtl2s668:190059:194758:1 gene:EMLSAG00000010112 transcript:EMLSAT00000010112 description:”augustus_masked-LSalAtl2s668-processed-gene-1.1″) HSP 1 Score: 102.064 bits (253), Expect = 2.195e-25Identity = 65/191 (34.03%), Postives = 101/191 (52.88%), Query Frame = 0 Query: 134 GKVALVTGAGGGLGKAYALLLASRGASVVVNDLGGSRTGEGQSSKAADEVVNEIRQKGGKAV—–GNYDSVEDGEAVIKTALDNFGRIDIVINNAGILRDRSIGRTSDSDWDLVQKVHLRGAFQVIRAAWPHMKKQKYGRIINTSSVAGIFGNFGQSNYSSAKAGLIGLTSTLAIEGERSGIQANVIVP 319 GKVAL+TGA G+G++ A+L A…

INTRODUCTION Next-generation sequencing (NGS) has revolutionized many areas of biological research (1, 2), providing ever-more data at an ever-decreasing cost. One such area is microbiome research, the study of microbes in their theater of activity using metagenomic sequencing (3). Here, deep short-read sequencing, and improving performance of long-read sequencing, are…

The taxonomy of the genus Neisseria remains confusing, particularly regarding Neisseria mucosa and Neisseria sicca. In 2012, ribosomal multi-locus sequence typing reclassified both as N. mucosa, but data concerning 17 N. sicca strains remain available in GenBank. The continuous progress of high-throughput sequencing has facilitated ready accessibility of whole-genome data,…

Although the hypothesis of gene-regulatory network (GRN) cooption is a plausible model to explain the origin of morphological novelties (1), there has been limited empirical evidence to show that this mechanism led to the origin of any novel trait. Several hypotheses have been proposed for the origin of butterfly eyespots,…

M. Madan Babus Group and the Center for Data-Driven Discovery in the Department of Structural Biology is seeking a highly driven, Full time Machine Learning Research Scientist support the Kalodimos and Babu Groups on the Blue Sky Initiative “Seeing the Invisible in Protein Kinases.” This project is supported by $35…

Errors /blast/moderated Leave a mail with to get this resolved. Contact: VIB / UGentBioinformatics & Evolutionary GenomicsTechnologiepark 927B-9052 GentBELGIUM+32 (0) 9 33 13807 (phone)+32 (0) 9 33 13809 (fax) Don’t hesitate to contact the in case of problems with the website! You are visiting an outdated page of the BEG/Van…

Serratus alignment architecture Serratus (v0.3.0) (github.com/ababaian/serratus) is an open-source cloud-infrastructure designed for ultra-high-throughput sequence alignment against a query sequence or pangenome (Extended Data Fig. 1). Serratus compute costs are dependent on search parameters (expanded discussion available: github.com/ababaian/serratus/wiki/pangenome_design). The nucleotide vertebrate viral pangenome search (bowtie2, database size: 79.8 MB) reached processing rates…

I recently had a script fail due to poor handling of BLAST output. The BLAST -outfmt staxids field usually returns a single taxid, but occasionally it returns two or more taxids separated by a semicolon, such as 556514;701533. Fixing the script to handle this should be fairly straightforward. But the…

News:NCBI looking for testers for a new web-only (for now) clustered `nr` database 0 Find details about how to participate by going to this link. Clustered nr is the standard NCBI nr database clustered with each sequence within 90% identity and 90% length to other members of the cluster. Your…

(PDF) AntiHunter: searching BLAST output for EST antisense transcripts | Alessandro Guffanti – Academia.edu Academia.edu uses cookies to personalize content, tailor ads and improve the user experience. By using our site, you agree to our collection of information through the use of cookies. To learn more, view our Privacy Policy. ×…

Conflicting results suggest a missing variant In order to narrow down candidates for the causal genetic variant, we performed genome-wide association mapping separately in individual lake populations (previously, association mapping was only performed across the whole species flock5). Interestingly, despite clear association peaks in the crater lakes (Fig. 1a, b), the…

. 2021 Dec 24;3(1):101072. doi: 10.1016/j.xpro.2021.101072. eCollection 2022 Mar 18. Affiliations Expand Affiliation 1 Department of Plant Pathology, Kansas State University, Manhattan, KS, USA. Free PMC article Item in Clipboard Jun Huang et al. STAR Protoc. 2021. Free PMC article Show details Display options Display options Format AbstractPubMedPMID . 2021 Dec…

1. Run a Delta-BLAST with the silkworm insulin protein (P26726). Limit to human proteins in theRefSeq_Protein database.How many total sequences? Get answer to your question and much more b. How many human homologs appear to have the insulin domain (irrespective of the e-valuethreshold)? Get answer to your question and much…

In bioinformatics, BLAST (Basic Local Alignment Search Tool) is an algorithm for comparing primary biological sequence information, such as the amino-acid sequences of different proteins or the nucleotides of DNA sequences. A BLAST search enables a researcher to compare a query sequence with a library or database of sequences, and…

Hi CJ-Chen, Thanks for developing this tool. I having an issue when I try to use Quick Run MCScanX Wrapper. error log here: [Debug…All Standard Error Info will show as following:…] Curr log file:/tmp/TBtools.14595798488989250861.20210723103734.log Curr java version:11.0.11 Curr TBtools version:1.09854 Maxmum Memory for Curr TBtools: 4162846720 curVersion:1.09854:force Fetch Location:200 Factor:0.1516546094367225…

I have a set of 100 amino acid sequences and I want to perform a BLASTP sesrch against the refseq_protein database. Accordingly I had set up the standalone version of BLAST (Version 2.11.0+) and downloaded the refseq_protein database from NCBI using the following code wget ftp.ncbi.nlm.nih.gov/refseq/release/complete/*.faa.gz The database gets downloaded…

Hi I’m new to bioinformatics and have just completed my first run on the MinION (long read sequencing Oxford Nanopore Technologies). I was hoping someone could direct me towards R packages, workflow, tutorials or guides that will help me identify species that are present in my sample mainly for fungi…

1. Eyun, S. Phylogenomic analysis of Copepoda (Arthropoda, Crustacea) reveals unexpected similarities with earlier proposed morphological phylogenies. BMC Evol. Biol. 17, 23 (2017). PubMed  PubMed Central  Google Scholar  2. Eyun, S. et al. Evolutionary history of chemosensory-related gene families across the Arthropoda. Mol. Biol. Evol. 34, 1838–1862 (2017). CAS  PubMed …

I’m getting an error trying to to use blast v2.12 against a local nt database. I’ve downloaded nt twice from the ftp server thinking the first time it was corrupt but that didn’t change anything. My command is: blastn -db nt -num_threads 8 -outfmt “6 qseqid sacc stitle ssciname nident…

$ mvn javadoc:aggregate … [INFO] — maven-javadoc-plugin:3.0.1:aggregate (default-cli) @ biojava-legacy — [ERROR] no module descriptor for org.biojava:biojava-legacy [ERROR] no module descriptor for org.biojava:bytecode [ERROR] no module descriptor for org.biojava:core [ERROR] no module descriptor for org.biojava:alignment [ERROR] no module descriptor for org.biojava:biosql [ERROR] no module descriptor for org.biojava:blast [ERROR] no module…

CONC 2006 SVM Eukaryotes (both protein-coding and non-coding genes) peptide length, amino acid composition, predicted secondary structure content, mean hydrophobicity, percentage of residues exposed to solvent, sequence compositional entropy, number of homologues, alignment entropy 10-fold CV on protein-coding: F1-score: 97.4% ☼ Precision: 97.1% ☼ Recall: 97.8% ◙ On non-coding: F1-score:…

Blast command line pipeline not working 0 Hello, I am running now a local blast pipeline using MacOs. The goal here is to take interval of the 5 best hits and then extract the SNP variants from multiple vcf.gz files. But I am facing an error which I cannot solve….

·  Job facts Summer Intern – (Bioinformatics) The Summer @ Roche Intern Program has been developed to provide students with a fun yet rewarding summer through hands-on experience and numerous opportunities to network with other interns as well as employees in the organization. Additionally, we help our students meet their…

18S gene not present in genome assembly? 0 I am designing PCR primers to amplify a region of the 18S rRNA gene of Penicillium expansum. As the template for primer design, I use the consensus sequence of a multiple sequence alignment of 18S sequences obtained from the SILVA database. When…

Hello community, I am trying to load the .gb file I got after blast on ncbi. Tried a few libraries, like “genbankr”, “read.gb”, but without success. I got the following error: library(read.gb) read.gb(“orig_with_blast.gb”, DNA = TRUE, Type = “full”, Source = “File”) Error in eval(parse(text = Order[i])) : object ‘ORGANISM’…

How to retrieve fasta sequence after local blast? 1 Hello, I have created a Blast database using a reference genome. Then, I have performed a local blast search in command line using a gene of interest. I have obtained some hits with the usual Blasting information. Now, I want to…

Blast database built error 1 makeblastdb -in nt -dbtype nucl -out nt Building a new DB, current time: 12/09/2021 15:55:27 New DB name: /home/internal/Databases/NT/NT_Jul2021/nt New DB title: nt Sequence type: Nucleotide Deleted existing Nucleotide BLAST database named /home/internal/Databases/NT/NT_Jul2021/nt Keep MBits: T Maximum file size: 1000000000B No volumes were created. Error:…

Hi QIIME support team, I’m attempting to install QIIME2 on my Windows 10 machine. I installed Anaconda3, then set up conda to run in Git Bash: echo “. ${PWD}/conda.sh” >> ~/.bashrc Once I restarted Git Bash and activated Conda, I installed python-wget because installation of wget kept getting the following…

Making a FASTA file from a segment of a DNA sequence 0 Hello everyone, I have copied a segment of a known DNA sequence and I want to turn this segment of DNA into a FASTA file in order to BLAST it against a custom made database. I mostly work…

How to extract homologous sequence data from multiple .vcf.gz files? 0 Hello, I have short read data from multiple samples stored as scaffolds.vcf.gz files. I have some gene sequence of interest. I want to find the closest homologous sequence of the respective genes from all the other samples. At first,…

This repository include scripts for analysis of biosynthetic gene clusters (BGCs) in large metagenome assemblies. All scripts were created within the Chernevaya Taiga project funded by the Russian Science Foundation (grant 19-16-00049). The repository also contains results of the scripts application to four hybrid (illumina + ONT) assemblies of various…

igBLAST query/options error 2 When I try to run this command: igblastn -germline_db_V $GERMLINE_DB”/human_gl_HV” -germline_db_J $GERMLINE_DB”/human_gl_HJ” -germline_db_D $GERMLINE_DB”/human_gl_HD” -organism human -domain_system imgt -query $WORKDIR”https://www.biostars.org/”$FILE”.fasta” -auxiliary_data $IGBLASTDIR”/optional_file/human_gl.aux” -outfmt 7 -num_threads 4 -num_alignments_V 5 -out $FILE”_tab.igblast” I get this error: BLAST query/options error: Germline annotation database human/human_V could not be found in…

standalone blastp: increasing word size extremely slows down the search 1 Hello, I need to blastp a genome (15,000 seqs) against genome (12,000 seqs) using Biopython. I decided to use local blast and query genome 1 fasta file against genome 2 database ( made by makeblastdb command with second genome…

Getting coordinates for a given sequence motif 2 I would like to get all coordinates for a given series of short sequence motifs, e.g. GATTACA (and its reverse complementary TGTAATC) from a reference genome, but want to do it in a way that allows me to get the coordinates of…

Finding a sequence 1 Hi, I have a sequence from ITS1 (MT895507, Genbank acess) and I need to finding similares sequences in other works. My goal is to find how many sequences are similar to mine in that other work (PRJNA335788). I was doing blast the SRA with my sequence…

This protocol demonstrates the use of a phenotype microarray (PM) technology platform to define metabolic requirements of Chlamydomonas reinhardtii, a green microalga, and refine an existing metabolic network model. The phenotype micro-array technology is an effective high-throughput method that functionally determines cellular metabolic activities in response to a wide array…

I want to find orthologues for a certain gene to determine if it’s conserved among related taxa. For this I’m using BLAST but I’m still sceptical if I use the tool in a right way. Should I use the protein data base for blasting or the nucleotide data base (or…

Hi all, I am designing pool of probes for fluorescent HCR in situ hybridization. I use blastn (blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch) to check the specificity of each probe by entering for instance “GACATTTACTTATGTGCAGAGAAAC XX CAATTTCCACGGACGCACTGACGTG” as the query and Mus Musculus as the Search Set. I usually do it one by one but…

Question 1: About how many different regions in your contig appear to have one or more matches to Swissprot? Which family of genes seems to predominate in the latter half of the contig? There appear to be 4 regions and the Hox gene seems to predominate the output. Question 2:…

BioPython : BLAST comparision and parsing output in particular format 1 I have query sequence, Suppose query: NNNNNNNNNNNNNNNNNN Database 1: Homo sapien Database 2: Mycobacterium tuberculosis I compared query sequence with above two Databases using Standalone BLAST individually and I got result as ex. Result1.txt and Result 2.txt. Now, I…

The number of mentions indicates the total number of mentions that we’ve tracked plus the number of user suggested alternatives. Stars – the number of stars that a project has on GitHub. Growth – month over month growth in stars. Activity is a relative number indicating how actively a project…

Hi all, For the first time, I am working on some de novo mRNAseq data already analyzed by a company (the same that perfomed the sequencing). The samples are from a species for which we don’t have an annotated genome. They assembled the transcriptome with trinity (which resulted in more…

getting sscinames in viral blastx query 2 I am running a local blast instance on my computer and I am trying to extract the sscinames from the database.  I downloaded the viral database from ftp.ncbi.nlm.nih.gov/refseq/release/viral and created the blast database (with taxID) via :  grep -i “Viral|virus” /reference/blast_database/refseq/RefSeq-release74.catalog &> viral_taxid.txt…

National Center for Biotechnology Information logo The National Center for Biotechnology Information (NCBI) is part of the United States National Library of Medicine (NLM), a branch of the National Institutes of Health. The NCBI is located in Bethesda, Maryland and was founded in 1988. The NCBI houses genome sequencing data…

mcscanx 0 I have made files as per given in example blast and gff file xyz.blast contains: Eg01_t003090.1 Eg01_t003090.1 100.00 306 0 0 1 306 1 306 5e-173 594 Eg01_t003090.1 Eg01_t003100.1 98.38 309 2 1 1 306 1 309 1e-171 590 Eg01_t003090.1 Mba03_g02610.1 93.46 306 19 1 1 306 1…

1. The Plant List. The Plant List—A Working List of All Plant Species (Royal Botanic Gardens, Kew and Missouri Botanical Garden, 2019). www.theplantlist.org/. Retrieved 20 Aug 2019. 2. Christenhusz, M. J. M. & Byng, J. W. The number of known plants species in the world and its annual increase. Phytotaxa…

1. Knecht, D. & Kaatz, H. H. Patterns of larval food production by hypopharyngeal glands in adult worker honey bees. Apidologie 21, 457–468, doi.org/10.1051/apido:19900507 (1990). Article  Google Scholar  2. Kamakura, M. Royalactin induces queen differentiation in honeybees. Nature 473, 478–483, doi.org/10.1038/nature10093 (2011). ADS  CAS  Article  PubMed  Google Scholar  3. Ramadan,…

Compare two protein FASTA files and give a excel that show header with the same sequence 2 Dear All, I have two files file1.fasta file2.fasta. Both contain some identical sequences but different headers. I want to know the correspondence relationship between the headers of the two fasta files and may…

Assembly Raw data obtained from eight human Norovirus samples passed FASTQC (v0.11.5, Babraham Bioinformatics) quality filters regarding the parameters per base sequence quality, per sequence average quality, N content and adapter sequences after the trimming steps described in the methods section. Mean read length was 100 bp as expected from library…

Running Assembly Jobs on the Cluster with Checkpointing NERSC Tutorial 2/12/2013 Alicia Clum How We Use Genepool? • Assembly – Fungal, Microbial, Metagenome • • • Alignments Error correction Kmer matching/counting Tool benchmarking Data preprocessing – Linker trimming, changing quality formats, changing read formats, etc • Post assembly improvement •…

Hi all!! I would like to share with you this little project I have been working on for a while now. I would greatly appreciate if you find bugs or manage to break it with your own data. sqzlib is a little fastA/Q encoding library that uses zlib or zstd…

#1000359 – FTBFS: test failure: External MBEDTLS version mismatch – Debian Bug report logs Reported by: Stefano Rivera <stefanor@debian.org> Date: Mon, 22 Nov 2021 02:15:02 UTC Severity: serious Found in version python-biopython/1.79+dfsg-1 Fix blocked by 1000358: ncbi-blast+: Please remove the mbedtls version check Reply or subscribe to this bug. Toggle…

Package: ncbi-blast+ Version: 2.11.0+ds-1 Severity: normal Affects: python-biopython Running blastn outputs: Critical: External MBEDTLS version mismatch: 2.16.9 headers vs. 2.16.11 runtime This causes python-biopython to FTBFS: ====================================================================== FAIL: test_blastn (test_NCBI_BLAST_tools.CheckCompleteArgList) Check all blastn arguments are supported. ———————————————————————- Traceback (most recent call last): File “/<<PKGBUILDDIR>>/.pybuild/cpython3_3.9/build/Tests/test_NCBI_BLAST_tools.py”, line 420, in test_blastn self.check(“blastn”, Applications.NcbiblastnCommandline)…

Abstract Background/Aim: Fusions of the paired box 3 gene (PAX3 in 2q36) with different partners have been reported in rhabdomyosarcomas and biphenotypic sinonasal sarcomas. We herein report the myocardin (MYOCD on 17p12) gene as a novel PAX3-fusion partner in a pediatric tumor with adverse clinical outcome. Materials and Methods: A…

Name Last modified Size Description Parent Directory   –   Affy/ 2014-05-29 05:25 –   Align/ 2014-06-11 10:27 –   AlignIO/ 2014-06-11 10:27 –   Alphabet/ 2014-06-11 10:27 –   Application/ 2014-05-29 05:25 –   Blast/ 2014-05-29 05:25 –   CAPS/ 2014-05-29 05:25 –   Cluster/ 2014-05-29 05:25 –  …

1 INTRODUCTION Sporotrichosis is the most predominant and worldwide deep-seated dermatomycosis. The causative fungi, Sporothrix spp., which inhabits soil, causes lesions when inoculated into skin or subcutaneous tissue by tiny wounds. Sporothrix schenckii had long been regarded as the only species causing sporotrichosis until Marimon et al.1, 2 conducted molecular…

blastn or tblastx for nucleotide blasts? 1 When we have both a nucleotide query sequence and a nucleotide database is it best to use tblastx? I read that tblastx is superior because it helps account for wobble bases in codons, but in many publications I simply see people using blastn….

Introduction Corn and soybean meal are the main components of high energy and high protein diets for pigs and are also the main raw materials of food products for human consumption, fermentation, and bioenergy industry (Sevillano et al., 2018). As the arable land of food crops was limited whereas the…

(PDF) Alkahest NuclearBLAST : a user-friendly BLAST management and analysis system | Charles Opperman – Academia.edu Academia.edu uses cookies to personalize content, tailor ads and improve the user experience. By using our site, you agree to our collection of information through the use of cookies. To learn more, view our Privacy…