Categories
Tag: CSI
Skip failed “mount” for notebook volumes – Zero to JupyterHub on Kubernetes
seb31 January 19, 2024, 2:17pm 1 Hello, We configured jupyterhub so that we mount NAS shares in our users’ notebooks, great.Some are NFS mounts, other are kerberized ones, and we also have some case where we use SMB CSI and mount shares based on k8s secrets containing user/password The problem…
Investigating environmental transmission to resolve a Bacillus cereus group outbreak in a neonatal intensive care unit using core genome multilocus sequence typing | Antimicrobial Resistance & Infection Control
Isolate characteristics From June 2020 to October 2021, our analysis included a total of 28 isolates from patient and environmental samples, all subjected to Whole Genome Sequencing (WGS) (refer to Table 1). To ensure robustness and minimize the influence of sequencing errors on our findings, all 28 WGS datasets maintained a…
Help getting the right blob mount permissions – Zero to JupyterHub on Kubernetes
Hello,I have a cluster running on AKS after following the guideI am trying to mount a static Azure Blob Storage (bring your own storage) shared by all of the singleuser pods (I have a custom spawner that mounts subdirectories of the blob). I have setup an SC, PV, and PVC…
csi-miR-96-5p delivered by Clonorchis sinensis extracellular vesicles promotes intrahepatic cholangiocarcinoma proliferation and migration via the ferroptosis-related PTEN/SLC7A11/GPX4 axis | Parasites & Vectors
Human tissue samples The preoperative diagnosis of CS mainly relies on stool microscopy, enzyme-linked immunosorbent assay, or endoscopy. Fresh liver and intrahepatic bile duct specimens were collected from ICC patients with (CS-ICC group) and without (NC-ICC group) CS infection during partial hepatectomy at the First Hospital of Jilin University. Tumor tissues…
Ocular Therapeutix(TM) Announces Proposed Public Offering of Common Stock
BEDFORD, Mass., Dec. 13, 2023 (GLOBE NEWSWIRE) — Ocular Therapeutix™, Inc. (Nasdaq: OCUL) (the “Company”), a biopharmaceutical company focused on the formulation, development, and commercialization of innovative therapies for diseases and conditions of the eye, today announced that it has commenced an underwritten public offering of its common stock. In…
Reproxalap in Patients with Seasonal Allergic Conjunctivitis
Introduction Reproxalap, a novel chemical entity in late-stage clinical development for the treatment of ocular inflammation, chemically sequesters a class of small molecules known as reactive aldehyde species (RASP). Via covalent binding to amine and thiol residues, RASP modulate the structure and function of proteins in an analog manner1 depending…
Research Assistant – Bioinformatician (Cancer Science Institute) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The Pitt Lab is a leading computational research group at the Cancer Science Institute of Singapore dedicated to making groundbreaking discoveries in cancer genomics using cutting-edge machine learning techniques. Our research focuses on the causes and consequences of genome instability. We explore this by combining software development and…
How to display a VCF/BCF file or stream as a paginated table in a python web framework (e.g. Django)?
How to display a VCF/BCF file or stream as a paginated table in a python web framework (e.g. Django)? 2 Does anyone know how display a VCF/BCF file or stream as a paginated table in a python web framework (e.g. Django)? Is this possible at all? The number of variants…
Research Assistant (Cancer Science Institute – Spatial Biology) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description This position is an appointment to Cancer Science Institute Microscopy and Multiplex Assays (MMA) Core. The MMA Core offers scientists a variety of paid services, ranging from basic histology processes to spatial proteomics and transcriptomics analysis. We are looking for a meticulous and dedicated Research Assistant to anchor the day-to-day running of…
S3 Express One Zone set to power generative AI workloads
AWS’ S3 object storage is shifting from being a data repository to a vital part of the stack for generative AI and machine learning development. That’s the idea behind S3 Express One Zone (EOZ), the public cloud’s latest S3 object storage service, according to Andy Warfield, vice president and…
China Stocks Trim Losses on Report State-Owned Firm Bought ETFs
(Bloomberg) — Chinese stocks rebounded in the afternoon following a report that a state institution bought exchange-traded funds, in what would be the latest policy effort to bolster markets. The CSI 300 Index closed down 0.4% after earlier falling more than 1%. The Shanghai Composite index ended in the green,…
‘More precious than gold’: How a long lost mole was rediscovered with the help of a border collie
The team described the hunt to find the mole as ‘more exciting’ than an episode of CSI. ADVERTISEMENT A blind mole that ‘swims’ in the sand has been found in South Africa, more than 80 years after the species was lost to science. The critically endangered De Winton’s golden mole…
Longitudinal detection of circulating tumor DNA
Analysis of Roche KAPA Target Enrichment kit experimental data obtained on an Illumina sequencing system is most frequently performed using a variety of publicly available, open-source analysis tools. The typical variant calling analysis workflow consists of sequencing read quality assessment, read filtering, mapping against the reference genome, duplicate removal, coverage…
Unhealthy hub pod, possible network problems? – Zero to JupyterHub on Kubernetes
We’re trying to resize (reduce) a z2jh running on an OpenStack Magnum-created k8s, and now seeing some problems with the hub pod, which may be related to networking. From the hub logs: [I 2023-11-07 17:59:20.318 JupyterHub app:1984] Not using allowed_users. Any authenticated user will be allowed. [D 2023-11-07 17:59:20.344 JupyterHub…
bcftools compressing and indexing vcf files
bcftools compressing and indexing vcf files 2 Hello, I am trying to merge multiple VCF files using bcftools but it threw an error saying that the file is not compressed. I want to know if the right command to compress the file would be: bcftools view -I input.vcf -O z…
Building multi-tenant JupyterHub Platforms on Amazon EKS
Introduction In recent years, there’s been a remarkable surge in the adoption of Kubernetes for data analytics and machine learning (ML) workloads in the tech industry. This increase is underpinned by a growing recognition that Kubernetes offers a reliable and scalable infrastructure to handle these demanding computational workloads. Furthermore, a…
papain family cysteine protease containing protein, maker-scaffold1702_size30647-snap-gene-0.14 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of papain family cysteine protease containing protein vs. L. salmonis genes Match: EMLSAG00000006045 (supercontig:LSalAtl2s:LSalAtl2s327:400616:404607:-1 gene:EMLSAG00000006045 transcript:EMLSAT00000006045 description:”augustus_masked-LSalAtl2s327-processed-gene-4.0″) HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0Identity = 283/525 (53.90%), Postives = 368/525 (70.10%), Query Frame = 0 Query: 49 GHVARPLGKSPPNFVRDPPPRTTPPAQWLWNNVNETNFLTVSRNQHLPTYCGSCWAHAATSSLSDRIKIARQGAWPDINLAPQVLISCGPGDGCHGGEAGDANAYMHAQGITDETCSIYRARGQDNGLPCSKLEICSTCE—SKCYQPQHFFTYRVDEFHDVEGESNGEQEANMMAEIHHRGPISCGIAVTQALV-NYTGGLFHDKTGAQEIDHDISVVGYGVDEGTQEKYWLIRNSWGTYWGEQGFFRLIRGVNNLGIESGTCSWATPADTWSDAARE—RAAILSNEITLQKP——LWKQLWTVVADFVDNTRDTDLFRRLKLMQKGCKKLSSPRVPVVNIRPRPQDYVSTADLPEALDWRSVNGTNFLSWSVNQHLPVYCGSCWAQAGLSSLADRFTIADRKRFANLALSVQYILNCQAGGSCHGGDAFPLYAFIQKQGVPDVTCQPYEALDEGPLTDCSKPSKLVCKDCTWPPPEPGQEGNCWAKEKFHRYYVDEYNGVEGADNMKKEILERGPVT 560 GH+ R G+…
Accessing a Google Storage Bucket mounted as a Persistent Volume – Zero to JupyterHub on Kubernetes
That’s good to know; probably means my error is somewhere in my config. I’ll try to dump the relevant settings. Output of kubectl get pod while starting a jupyterhub user server: NAME READY STATUS RESTARTS AGE continuous-image-puller-972b7 1/1 Running 0 24m continuous-image-puller-tz5ls 1/1 Running 0 26h gcs-fuse-csi-static-pvc 2/2 Running 0…
AI Infra Day | Hands-on Lab: CV Model Training with PyTorch & Alluxio on Kubernetes
This hands-on session discusses best practices for using PyTorch and Alluxio during model training on AWS. Shawn and Lu provide a step-by-step demonstration of how to use Alluxio on EKS as a distributed cache to accelerate computer vision model training jobs that read datasets from S3. This architecture significantly improves…
The exciting world of wildlife CSI, and its absolute necessity
When we think of illegal international trade, images of drug cartels, and children being used for domestic labour come to mind. But did you know that after the illegal trafficking of drugs and humans for labour, the illegal wildlife trade is the third largest global market? PREMIUM Despite CITES, populations…
Organoids Market to Witness Robust Growth in the Coming Decade, Projected to Reach US$ 205.3 Million by 2033 | FMI
A recent Future Market Insights analysis projects that the worldwide organoids market will expand between 2023 and 2033 at a CAGR of 13%. The market is anticipated to be worth US$ 205.3 million by the end of the forecast period. In 2023, the market is expected to be worth US$…
Senior Research Scientist, Bioinfomatician (Cancer Science Institute) job with NATIONAL UNIVERSITY OF SINGAPORE
(JR:21694) Job Description The position of Postdoctoral Fellow – with an emphasis on computational cancer genomics – is immediately available at the Cancer Science Institute of Singapore (a part of National University of Singapore). The Postdoctoral Fellow will work with the laboratories of Professor Ashok Venkitaraman, on a project studying the…
University of Melbourne – Research Officer
Agency: Faculty of Medicine, Dentistry and Health Sciences Job no: 0055821 Work type: Fixed Term Location: Parkville Categories: Various categories Job no: 0055821 Location: ParkvilleRole type: Full-time; Fixed-term for 12 monthsFaculty: Medicine, Dentistry and Health SciencesDepartment/School: Department of Microbiology and Immunology, School of Biomedical SciencesSalary: Level A – $80,258 – $108,906 p.a. plus 17% super…
What Happened to Stacey Dash on College Hill? Where is Stacey Dash Now?
Stacey Dash’s sudden departure from College Hill, a reality series, has created buzz and speculation. The controversial actress walked off the set in the middle of the season after reportedly performing poorly on a test about Black History.Stay informed about the latest developments, discover intriguing facts, and gain valuable insights…
Screening Market Poised for Remarkable 12.4% CAGR Surge, Projected to Reach US$ 4.32 Billion by 2033 | FMI
The global Carrier Screening Market is expected to record a CAGR of 12.4% between 2023 and 2033, with a size estimated in 2023 at US$ 1,343.40 million. The market’s value is expected to rise to US$ 4,323.84 million by 2033. As a result of increased funding from the public and…
The Y-ome Conundrum: Insights into Uncharacterized Genes and Approaches for Functional Annotation
Csako G (2006) Present and future of rapid and/or high-throughput methods for nucleic acid testing. Clin Chim Acta 363:6–31. doi.org/10.1016/j.cccn.2005.07.009 Article CAS PubMed Google Scholar Sanger F, Coulson AR, Friedmann T et al (1978) The nucleotide sequence of bacteriophage φX174. J Mol Biol 125:225–246 Article CAS PubMed Google Scholar Sawicki…
Error executing nf-core/metaboigniter pipeline
Error executing nf-core/metaboigniter pipeline 0 I ran this command: export NXF_VER=22.10.8; nextflow run nf-core/metaboigniter -profile test The error obtained: Error executing process > ‘get_software_versions’ Caused by: Process `get_software_versions` terminated with an error exit status (127) Command executed: echo 1.0.1 > v_pipeline.txt echo 22.10.8 > v_nextflow.txt Rscript -e “cat(as.character(packageVersion(‘CAMERA’)),’\n’)” &> v_camera.txt…
Bioinformatics Scientist jobs in International Business Park
Illumina is seeking a highly driven and talented bioinformatics scientist to join the Bioinformatics organization, where we are… The Bioinformatics & DRAGEN HW SW department at Illumina is looking for a bioinformatics scientist with strong technical depth in genetic… National University of Singapore $6,000 – $12,000 per month A position…
Senior Research Scientist – Bioinfomatician (Cancer Science Institute) (JR:21694) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The position of Postdoctoral Fellow – with an emphasis on computational cancer genomics – is immediately available at the Cancer Science Institute of Singapore (a part of National University of Singapore). The Postdoctoral Fellow will work with the laboratories of Professor Ashok Venkitaraman, on a project studying the evolution…
Postdoctoral Fellow (Cancer Science Institute) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The Cancer Science Institute of Singapore (CSI Singapore) Career Accelerator Postdoctoral Fellowship invites outstanding applicants at the level of early-stage postdoctoral fellows. The awardees will be hosted within established research labs at CSI Singapore to develop their independent research programs and collaborate with other exceptional researchers. They will…
Research Fellow, Bioinformatician (Cancer Science Institute) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description (JR:18151) The position of Postdoctoral Fellow – with an emphasis on computational cancer genomics – is immediately available at the Cancer Science Institute of Singapore (a part of National University of Singapore). The Postdoctoral Fellow will work with the laboratories of Professor Ashok Venkitaraman, on a project studying the evolution of…
How These Young, Female Scientists Are Like Google to Soldiers > U.S. Department of Defense > Story
Within the Army, there’s a small group of civilian scientists who are hard at work protecting soldiers by analyzing soil, water and air samples to identify what they are and determine if they’re dangerous. These civilians work for the Army’s 20th Chemical, Biological, Radiological, Nuclear, Explosives Command in the CBRNE…
Research Fellow – Bioinformatician (Cancer Science Institute) – Dr Jason Pitt’s Lab job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The mission of Cancer Science Institute (National University of Singapore) is to better understand the causes of human cancer across Asia, and thereby improve its detection, treatment, and prevention. Our outstanding researchers and exceptional facilities create an energetic environment for ground-breaking science and world-class training. The position of…
Plasticity of circulating tumor cells in small cell lung cancer
Liquid biopsy samples Patients with histological or cytological confirmation of chemotherapy-naive SCLC were recruited and consented at The Christie NHS Foundation Trust according to an ethically approved protocol (NHS Northwest 9 Research Ethical Committee). Informed written consent was obtained from all subjects. Experimental protocols were approved by the Institutional Review board of…
Researchers develop novel approach for predicting resistance against cancer therapy
Multispectral microscopy with quantitative immunofluorescence is a state-of-the-art technology that can detect oncogenes simultaneously, allowing for the identification of bad co-expressing cells that can predict the survival outcome of cancer patients. Credit: Cancer Science Institute – image created with BioRender A team of researchers from the Cancer Science Institute of…
Researchers discover new approach for predicting resistance against cancer therapy
9 hours ago The most prevalent form of blood cancer in Singapore and the world diffuse large B cell lymphoma DLBCL has been linked to an unusual combination of oncogenes that may predict treatment resistance and consequently unfavourable outcomes in patients This research was conducted by a team from the…
NUS researchers develop novel approach for predicting resistance against cancer therapy
Newswise — A team of researchers from the Cancer Science Institute of Singapore (CSI Singapore) at the National University of Singapore (NUS), led by Assistant Professor Anand Jeyasekharan, has discovered a unique combination of oncogenes that could predict treatment resistance, and hence unfavourable outcomes, of patients with Diffuse large B…
DNA forensic scientist Monica Quall says she works at her ‘dream job’ – American Press
DNA forensic scientist Monica Quall says she works at her ‘dream job’ Published 4:19 am Friday, July 7, 2023 For as long as she can remember, Monica Quall has been a science fan. “It became more serious when I attended a week-long hands-on forensic science summer camp in middle school,”…
how to pass Bam and Bam index as Input Channel?
Nextflow: how to pass Bam and Bam index as Input Channel? 2 I would like to pass in bam files pair_id.sorted.bam and their corresponding index files pair_id.sorted.bam.csi into a nextflow workflow. However I am having trouble passing in the files, with errors being thrown for def indexFile = new File(“${it.getPath()}.bai”)….
BRAKER for large genome?
BRAKER for large genome? 0 I have a genome assembly of 2.1 GB, and I’m working on annotation with BRAKER2. I have lots of RNAseq data, and I was hoping to use that, as well as the OrthoDB arthropod protein set for gene prediction in –etpmode mode. However, samtools threw…
Research Assistant (Cancer Science Institute) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The mission of Cancer Science Institute (National University of Singapore) is to better understand the causes of human cancer across Asia, and thereby improve its detection, treatment, and prevention. Our outstanding researchers and exceptional facilities create an energetic environment for ground-breaking science and world-class training. A Research Assistant position is…
Principal Bioinformatics Scientist I – Fast Hire at F. Hoffmann-La Roche Ltd in Cape Town, Western Cape
We are on the lookout for a remarkable Principal Bioinformatics Scientist I to join our incredible team at F. Hoffmann-La Roche Ltd in Cape Town, Western Cape.Growing your career as a Full Time Principal Bioinformatics Scientist I is a great opportunity to develop competitive skills.If you are strong in critical…
How Alabama used DNA to solve cold case of murdered teenage girls
In 1999, two 17-year-old girls in south Alabama made calls from a payphone, telling their parents they were lost on the way home from a birthday party. The next day, they were found shot dead in the trunk of their car parked near a small hospital in Ozark. The crime…
acCRISPR: an activity-correction method for improving the accuracy of CRISPR screens
acCRISPR framework acCRISPR performs essential gene identification by calculating two scores for each sgRNA, namely the cutting score (CS) and the fitness score (FS). CS and FS are the log2-fold change of sgRNA abundance in the appropriate treatment sample with respect to that in the corresponding control sample (see Supplementary…
[slurm-users] Reservation with REPLACE_DOWN flag not replacing down nodes
I have this reservation which has the REPLACE_DOWN flag set: ReservationName=test StartTime=2020-12-14T09:00:00 EndTime=2023-12-14T09:00:00 Duration=1095-00:00:00 Nodes=traverse-k05g4 NodeCnt=1 CoreCnt=32 Features=(null) PartitionName=all Flags=IGNORE_JOBS,WEEKDAY,SPEC_NODES,REPLACE_DOWN,NO_HOLD_JOBS_AFTER_END TRES=cpu=128 Users=(null) Groups=(null) Accounts=pppl,csi,pu,tromp,cses Licenses=(null) State=ACTIVE BurstBuffer=(null) Watts=n/a MaxStartDelay=(null) Unfortunately, the one node in that reservation is down, and the reservation isn’t being moved to…
Research Fellow (Cancer Science Institute of Singapore) 1 job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description A postdoctoral position is available immediately for an extremely motivated Ph.D with a strong background in molecular or cellular biology, biochemistry, or other related fields. The successful candidate will help design and conduct experiments, analyse data, write papers and grants. Projects involve studying the novel mechanisms of replication…
Potential targets against natural killer/T-cell lymphoma found
A team of researchers from the Cancer Science Institute of Singapore (CSI Singapore) at the National University of Singapore (NUS) has discovered that a transcription factor, TOX2, was aberrantly increased in patients with natural killer/T-cell lymphoma (NKTL). The increased TOX2 level leads to the growth and spread of NKTL, as…
htslib-1.15.1-2.fc38 – Fedora Packages
htslib-1.15.1-2.fc38 – Fedora Packages ↵ Return to the main page of htslibView buildSearch for updates Package Info (Data from x86_64 build) Changelog Dependencies Provides Files Changelog Date Author Change 2023-01-19 Fedora Release Engineering <releng at fedoraproject dot org> – 1.15.1-2 – Rebuilt for fedoraproject.org/wiki/Fedora_38_Mass_Rebuild 2022-08-15 John Marshall <jmarshall at hey…
Automating CRISPR-based cell line development
The growing demand for more rapid high-throughput cell-line development and improved screening in the pharmaceutical space is motivating research facilities and companies to automate their labs. Though robotics has been present in some laboratories for around four decades, it is becoming increasingly common. It helps to free researchers of repetitive…
Research Fellow – Bioinformatician (Cancer Science Institute) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description (JR:18151) The position of Postdoctoral Fellow – with an emphasis on computational cancer genomics – is immediately available at the Cancer Science Institute of Singapore (a part of National University of Singapore). The Postdoctoral Fellow will work with the laboratories of Professor Ashok Venkitaraman, on a project studying the evolution of…
Human DNA Is All Over The Planet, And Scientists Are Worried : ScienceAlert
Every skin flake, hair follicle, eyelash, and spit drop cast from your body contains instructions written in a chemical code, one that is unique to you. According to a new study, technology has advanced to the point that it’s now possible to sift scraps of human DNA out of the…
Senior Research Scientist, Bioinformatician (Cancer Science Institute) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The mission of Cancer Science Institute (National University of Singapore) is to better understand the causes of human cancer across Asia, and thereby improve its detection, treatment, and prevention. Our outstanding researchers and exceptional facilities create an energetic environment for ground-breaking science and world-class training. A Senior Research Scientist position…
Research Fellow (Cancer Science Institute of Singapore) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The mission of Cancer Science Institute (National University of Singapore) is to better understand the causes of human cancer across Asia, and thereby improve its detection, treatment, and prevention. Our outstanding researchers and exceptional facilities create an energetic environment for ground-breaking science and world-class training. The position of…
Metagenome-based metabolic modelling predicts unique microbial interactions in deep-sea hydrothermal plume microbiomes
Design of this study In this study, we use 98 MAGs described previously from Guaymas Basin hydrothermal plumes (see Metagenomic datasets and model building in Methods) to understand metabolic interactions and evolution in hydrothermal systems (Refer Supplementary File S1 for the short name references used in this article). Both bacteria and archaea…
Research Fellow, Bioinformatician, Cancer Science Institute, Dr Jason Pitt’s Lab job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The position of Postdoctoral Fellow with an emphasis on cancer genomics and bioinformatics is immediately available in the laboratory of Dr. Jason Pitt, which integrates data science and biological expertise to facilitate precision oncology. The Pitt Laboratory achieves this by developing cutting-edge software that allows rapid interrogation and…
Characterization of a fold in TANGO1 evolved from SH3 domains for the export of bulky cargos
Constructs MOTH domains of human TALI (23-123), Otoraplin (18-128), and MIA (19-131), and TANGO1 (30-139) from Drosophila melanogaster (dmTANGO1(30-139)) were expressed from codon-optimized sequences in a modified pQE40 expression vector36 in M15 pRep4 E. coli strain. Human TANGO1 (21-131) (hsTANGO1 (21-131)) and TANGO1 (21-151) (hsTANGO1 (21-151)) were expressed from codon-optimized…
JupyterHub share folder – Zero to JupyterHub on Kubernetes
Can we have share folder/volumn between pods , which are created by Jupyterhub users gcerar April 18, 2023, 9:30pm 2 Sure you can. On our setup, we have something like singleuser: … storage: capacity: 10Gi extraVolumes: – name: shm-volume emptyDir: medium: Memory – name: jupyterhub-shared persistentVolumeClaim: claimName: jupyterhub-shared-volume – name:…
Carrier Screening Market is projected to exhibit a CAGR of 12.4% from 2023 to 2033 | Exclusive Report by FMI
The global carrier screening market is expected to record a CAGR of 12.4% between 2023 and 2033, with a size estimated in 2023 at US$ 1,343.40 million. The market’s value is expected to rise to US$ 4,323.84 million by 2033. As a result of increased funding from the public and commercial sectors…
Wiki, Biography, Age, Family, Career, Net Worth, Boyfriend, and More
Introduction: Stacey Lauretta Dash was born in The Bronx, New York, in the United States on January 20, 1966. She is a former talk show presenter and American actress best known for co-starring Dionne Marie Davenport in the 1995 movie Clueless and the corresponding television series. _image source: theguardian.com Today…
bam index chromosome size limit
Hello everyone, hope you are doing well SAM/BAM file format specification says that there is a limit to chromosome size that prevents indexing of .bam file, if reference genome had exceptionally large chromosomes. The limit is 2^29-1, which is around 500 M.b.p. This is quite a lot, for example, all…
Research Assistant (Bioinformatician) (Cancer Science Institute, NUS) job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The position of Research Assistant (Bioinformatician) is immediately available in the Genome and Data Analytics Core (GeDaC) at the Cancer Science Institute of Singapore (CSI) — a part of National University of Singapore. The CSI GeDaC is building a platform to facilitate the automated processing and analysis of…
Carrier Screening Market to Reach USD 4,323.84 Million, by
NEWARK, Del, March 08, 2023 (GLOBE NEWSWIRE) — The global carrier screening market is expected to record a CAGR of 12.4% between 2023 and 2033, with a size estimated in 2023 at US$ 1,343.40 million. The market’s value is expected to rise to US$ 4,323.84 million by 2033. As a…
Postdoctoral Fellow, Cancer Science Institute job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The Cancer Science Institute of Singapore (CSI) Career Accelerator Postdoctoral Fellowship invites outstanding applicants at the level of early-stage postdoctoral fellows. The awardees will be hosted within established research labs to develop their independent research programs and collaborate with other exceptional researchers. They will receive a competitive salary package with an…
Alignment File Processing | Variant Analysis
Learning objectives Differentiate between query-sorted and coordinate-sorted alignment files Describe and remove duplicate reads Process a raw SAM file for input into a BAM for GATK The processing of the alignment files (SAM/BAM files) can be done either with samtools or Picard and they are for the most part interchangable….
Research Officer, Bioinformatics job with UNIVERSITY OF MELBOURNE
Location: Parkville Role type: Full-time; Fixed-term for 1 year Faculty: Medicine, Dentistry and Health Sciences Department/School: Doherty Institute, Department of Microbiology and Immunology Salary: Level A – $97,558 – $104,717 p.a. plus 17% super The University of Melbourne would like to acknowledge and pay respect to the Traditional Owners of the lands upon which our campuses…
Ubuntu Manpage: samtools index – indexes SAM/BAM/CRAM files
Provided by: samtools_1.10-3_amd64 NAME samtools index – indexes SAM/BAM/CRAM files SYNOPSIS samtools index [-bc] [-m INT] aln.bam|aln.cram [out.index] DESCRIPTION Index a coordinate-sorted BGZIP-compressed SAM, BAM or CRAM file for fast random access. (Note that this does not work with uncompressed SAM files.) This index is needed when region arguments are…
DNA Evidence is Not as Reliable as Many Believe it to Be
TV-shows like CSI and Bones, have seared in the public consciousness the image of the faultless crime fighting forensic scientist and infallibility of DNA evidence. But the reality is that DNA evidence is not what many believe it to be – it is, in fact, susceptible to human errors including…
Investment in Advanced Technology by Leading Firms to Pump Up Future Market Expansion; Carrier Screening Market to Grow at a CAGR of 12.4% through 2033.
The global carrier screening market is expected to record a CAGR of 12.4% between 2023 and 2033, with a size estimated in 2023 at US$ 1,343.40 million. The market’s value is expected to rise to US$ 4,323.84 million by 2033. As a result of increased funding from the public and…
Research Fellow, Bioinformatician, Cancer Science Institute, Dr Jason Pitt’s Lab 1 job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The position of Postdoctoral Fellow with an emphasis on cancer genomics and bioinformatics is immediately available in the laboratory of Dr. Jason Pitt, which integrates data science and biological expertise to facilitate precision oncology. The Pitt Laboratory achieves this by developing cutting-edge software that allows rapid interrogation and…
Recommendations on Dynamic PersistentVolumes on Newer AWS EKS Versions – Zero to JupyterHub on Kubernetes
Hello,I’ve been walking through z2jh documentation which is thorough and great! I set up an AWS EKS cluster with eksctl. I then helm install jupyterhub-2.0.0. The newer versions of EKS tend to use the EBS CSI driver for dynamic PersistentVolume provisioning using the annotation: volume.beta.kubernetes.io/storage-provisioner: kubernetes.io/aws-ebs Your older storage documentation…
Jupyterhub is not tracking Keycloak’s sessions – Zero to JupyterHub on Kubernetes
Hello,I have installed the Jupyterhub chart with this chart.yaml: annotations: artifacthub.io/images: | – image: jupyterhub/configurable-http-proxy:4.5.3 name: configurable-http-proxy – image: jupyterhub/k8s-hub:2.0.0 name: k8s-hub – image: jupyterhub/k8s-image-awaiter:2.0.0 name: k8s-image-awaiter – image: jupyterhub/k8s-network-tools:2.0.0 name: k8s-network-tools – image: jupyterhub/k8s-secret-sync:2.0.0 name: k8s-secret-sync – image: jupyterhub/k8s-singleuser-sample:2.0.0 name: k8s-singleuser-sample – image: k8s.gcr.io/kube-scheduler:v1.23.10 name: kube-scheduler – image: k8s.gcr.io/pause:3.8…
10 BAM (Bioinformatics Alignment/Map) Best Practices
Bioinformatics Alignment/Map (BAM) is a powerful tool used to analyze and compare biological sequences. BAM is used to identify genetic variations, detect structural rearrangements, and compare different genomes. It is an essential tool for many areas of bioinformatics, including genomics, proteomics, and transcriptomics. In this article, we will discuss 10…
Research Scientist, Bioinformatician, Cancer Science Institute 1 job with NATIONAL UNIVERSITY OF SINGAPORE
JOB DESCRIPTION Analyze and integrate various NGS data Build and reproduce pipelines to process all types of DNA and RNA sequencing data Maintain all source code within Git and Dockerize all pipeline components Liaise with the Scaling Unit to convert pipelines into scalable workflows To…
Research Assistant, Bioinformatician / Cancer Science Institute, NUS job with NATIONAL UNIVERSITY OF SINGAPORE
Job Description The position of Research Assistant (Bioinformatician) is immediately available in the Genome and Data Analytics Core (GeDaC) at the Cancer Science Institute of Singapore (CSI) — a part of National University of Singapore. The CSI GeDaC is building a platform to facilitate the automated processing and analysis of…
Did Stacey Dash bleach her skin? Here are before and after photos after what looks like skin lightening
Did Stacey Dash bleach her skin? Here are before and after photos after what looks like skin lightening Hello Everyone lastest Update about Did Stacey Dash bleach her skin? Here are before and after photos after what looks like skin lightening Welcome guys to Bulletinzone.com . Here you can Find…
How To Install libhts-dev on Kali Linux
In this tutorial we learn how to install libhts-dev on Kali Linux. libhts-dev is development files for the HTSlib Introduction In this tutorial we learn how to install libhts-dev on Kali Linux. What is libhts-dev HTSlib is an implementation of a unified C library for accessing common file formats, such…
Stacey Dash Bio, Age, Height, Career , Family, Salary, And Net Worth
Stacey Dash Biography Stacey Dash is a native American actress and former talk show host. In the 1995 feature picture clueless and its television series of the same name, she portrayed Dionne Marie Davenport. She appeared on television in the NBC 1982 drama pilot Farrell: For the people, that got…
Extensively drug resistant E. coli LZ00114
Introduction Escherichia coli is a common Gram-negative opportunistic pathogen that causes invasive host infections through virulence factors such as flagella, toxin secretion, and adhesins. According to the source of the infection, pathogenic E. coli can be classified as intestinal (diarrheagenic) and extraintestinal (ExPEC). Uropathogenic E. coli (UPEC) is the most…
File “sage/symbolic/pynac_impl.pxi”, Exception. Unhandled SIGSEGV: A segmentation fault occurred
I am not sure if this is a bug in Python or sagemath. Using sagemath 9.5 on Linux Arch. I’ll describe the problem in words, then given MWE to reproduce it. I have an integrand integrand = “F(x)*(-x^2+x)^(1/2)” as string. I pass it to a subprocess using multiprocessing. When I…
Install pytorch in jetson nano
install pytorch in jetson nano Done! Getting Started with Jetson Nano In this tutorial, you will learn how to set up the NVIDIA ® Jetson ™ Nano and install everything you need to use the full power of the tiny embedded board. Git – Version Contol…
Containerization: Kubernetes 1.23 stabilizes operation with two network stacks
Kubernetes 1.23 is the third and final release of container orchestration this year. Among other things, it stabilizes the dual-stack operation in the cluster, the horizontal pod autoscaler and generic ephemeral volumes. With the new functions, initially introduced as alpha, the server-side validation of fields and the connection to OpenAPI…
Bam indexing error-the samtools index command for just 1 chromosome is also not working in this case, the following error is showing [E::hts_idx_push] Region 536871288..536871299 cannot be stored in a bai index. Try using a csi index with min_shift = 14, n_lvls >= 6 samtools index: failed to create index for P2R1R2_aln_sorted.bam”: Numerical result out of range.
Ask questionsBam indexing error-the samtools index command for just 1 chromosome is also not working in this case, the following error is showing [E::hts_idx_push] Region 536871288..536871299 cannot be stored in a bai index. Try using a csi index with min_shift = 14, n_lvls >= 6 samtools index: failed to create…
Newly developed software unveils relationships between RNA modifications and cancers
In a research breakthrough, a team of researchers from the Cancer Science Institute of Singapore (CSI Singapore) at the National University of Singapore has developed a software that can help reveal the relationships between RNA modifications and the development of diseases and disorders. Led by Professor Daniel Tenen and Dr…