Tag: HPV

Highlights of the 2024 JPM Healthcare Conference

Like every year, 2024 kicked off with a bang for the biotech industry, as thousands gathered at the J.P. Morgan Health Conference (JPM) that took place in San Francisco, last week. One of the largest healthcare conventions in the world, JPM recaps the glories as well as the gloom of…

Continue Reading Highlights of the 2024 JPM Healthcare Conference

HPV DNA testing proven effective in cervical cancer prevention – myRepublica

KATHMANDU, Jan 1: Cervical cancer claims the lives of many women prematurely, but a simple test can be a lifesaver—the HPV DNA test. This test detects the presence of the Human Papillomavirus (HPV), which is the cause behind cervical cancer. Doctors say that if the Human Papillomavirus (HPV) is detected…

Continue Reading HPV DNA testing proven effective in cervical cancer prevention – myRepublica

CRISPR-Cas12a-Enhanced Mass Spectrometric DNA Nanomachine for HPV-16 Detection in Human Serum

Cervical cancer is the second most harmful cancer to women, while human papillomavirus (HPV)-16 is the main cause of cervical cancer. Early virus screening can reduce the risk of death, but sometimes challenged by the low concentration and complicated matrix in physiological samples such as human serums. Herein, we report…

Continue Reading CRISPR-Cas12a-Enhanced Mass Spectrometric DNA Nanomachine for HPV-16 Detection in Human Serum

Timeline: What will health care look like 20 years in the future?

Next-generation diagnostic platforms COVID-19 was a wakeup call, exposing the limitations of many current diagnostic platforms. Innovations in diagnostic testing, driven by the need to respond to COVID-19, could help provide essential tools in the fight against other diseases. Diagnostic tools are critical to improving global health. Lessons learned…

Continue Reading Timeline: What will health care look like 20 years in the future?

Why are HEK293 cells used for transfection?

What is one example of ongoing gene therapy can be used in keratoplasty?5 answersGene therapy in ophthalmology has shown potential for use in keratoplasty. The cornea is an ideal target for gene therapy due to its accessibility, low volume, and special immunological status. Studies have focused on improving gene transfer…

Continue Reading Why are HEK293 cells used for transfection?

CRISPR/Cas12a-Responsive Hydrogels for Conjugation-Free and Universal Indicator Release in Colorimetric Detection

Recent advances have demonstrated the significant potential and advantages to repurpose existing point-of-care reactions/devices to realize portable detection of nonoriginal targets, e.g., pathogen genes. However, pursuing this aim usually requires protein indicator-nucleic acid conjugation via a covalent bond, which may bring drawbacks such as high cost, complicated procedure, and annoying…

Continue Reading CRISPR/Cas12a-Responsive Hydrogels for Conjugation-Free and Universal Indicator Release in Colorimetric Detection

Psychological impact of additional findings detected by genome-wide Non-Invasive Prenatal Testing (NIPT): TRIDENT-2 study

Lo YMD, Corbetta N, Chamberlain PF, Rai V, Sargent IL, Redman CWG, et al. Presence of fetal DNA in maternal plasma and serum. Lancet. 1997;350:485–7. Article  CAS  PubMed  Google Scholar  Warsof SL, Larion S, Abuhamad AZ. Overview of the impact of noninvasive prenatal testing on diagnostic procedures. Prenat Diagn. 2015;35:972–9….

Continue Reading Psychological impact of additional findings detected by genome-wide Non-Invasive Prenatal Testing (NIPT): TRIDENT-2 study

Bioinformatics analysis of immune characteristics in tumors with alternative carcinogenesis pathways induced by human papillomaviruses | Virology Journal

de Martel C, Georges D, Bray F, Ferlay J, Clifford GM. Global burden of cancer attributable to infections in 2018: a worldwide incidence analysis. Lancet Glob Health. 2020;8:e180–90. Article  PubMed  Google Scholar  McKaig RG, Baric RS, Olshan AF. Human papillomavirus and head and neck cancer: epidemiology and molecular biology. Head…

Continue Reading Bioinformatics analysis of immune characteristics in tumors with alternative carcinogenesis pathways induced by human papillomaviruses | Virology Journal

Targeting the epigenome to reinvigorate T cells for cancer immunotherapy | Military Medical Research

Tsui C, Kretschmer L, Rapelius S, Gabriel SS, Chisanga D, Knöpper K, et al. MYB orchestrates T cell exhaustion and response to checkpoint inhibition. Nature. 2022;609(7926):354–60. Article  CAS  PubMed  PubMed Central  Google Scholar  Zhu L, Zhou X, Gu M, Kim J, Li Y, Ko CJ, et al. Dapl1 controls NFATc2…

Continue Reading Targeting the epigenome to reinvigorate T cells for cancer immunotherapy | Military Medical Research

Pan-Cancer Analysis and Validation of Opioid-Related Receptors Reveals

Introduction The potential role of opioids used in oncology patients has been controversial. Epidemiological and retrospective studies have demonstrated that lower opioid doses and regional anesthesia (epidural, intrathecal, or paravertebral) for breast,1 colon,2 or melanoma3 are linked to lower rates of cancer recurrence, while general anesthesia with high opioid doses…

Continue Reading Pan-Cancer Analysis and Validation of Opioid-Related Receptors Reveals

HPV Tumor DNA May Offer Early Warning of Cervical Cancer at High Risk of Relapse

HPV-positive circulating tumor (ct)DNA after chemoradiation (CRT) for cervical cancer had an independent association with worse outcomes, suggesting potential as a biomarker to guide decision-making, a prospective, multicenter study showed. Patients with detectable HPV ctDNA at the end of CRT had significantly worse 2-year progression-free survival as compared with undetectable…

Continue Reading HPV Tumor DNA May Offer Early Warning of Cervical Cancer at High Risk of Relapse

how to get ER, PR and HER2 data from TCGA BRCA

how to get ER, PR and HER2 data from TCGA BRCA 2 Hi I have dowloaded the BRCA data from TCGA using TCGABiolinks I have done this: BRCARnaseqSE <- GDCprepare(query.a, directory = “BRCA_all”) sample.info <- SummarizedExperiment::colData(BRCARnaseqSE) Now I want to get data on ER, PR and HER2 – positive, negative…

Continue Reading how to get ER, PR and HER2 data from TCGA BRCA

CRISPR therapies Pipeline Insights 2023: Therapies, Latest

CRISPR therapies Pipeline (New York, USA) “CRISPR therapies Pipeline Insight, 2023” report by DelveInsight outlines comprehensive insights into the present clinical development scenario and growth prospects across the CRISPR therapies Market. The CRISPR therapies Pipeline report embraces in-depth commercial and clinical assessment of the pipeline products from the pre-clinical developmental…

Continue Reading CRISPR therapies Pipeline Insights 2023: Therapies, Latest

Advancing personalized medicine in brain cancer: exploring the role of mRNA vaccines | Journal of Translational Medicine

Personalized medicine aims to revolutionize healthcare by providing tailored treatments based on an individual’s unique characteristics. Genetic information of the host and target plays a crucial role in determining disease susceptibility and treatment response [1, 2]. By utilizing genomic analysis, biomarker identification, risk assessment, tailored treatment strategies, and continuous monitoring,…

Continue Reading Advancing personalized medicine in brain cancer: exploring the role of mRNA vaccines | Journal of Translational Medicine

Student research celebrated at Health Sciences Research Day

MU School of Medicine students presented roughly 250 research projects at the annual 2023 Health Sciences Research Day (HSRD), held Nov. 10, 2023, and featured the work of undergraduates, medical and nursing students, PhD students and postdoctoral trainees. The research posters covered a variety of topics within the health care…

Continue Reading Student research celebrated at Health Sciences Research Day

mRNA Vaccines and Therapeutics Combine Power and Finesse

By Kathy Liszewski Medical applications of mRNA technology are in the spotlight—not just mRNA-based vaccines, but mRNA-based therapeutics, too. The mRNA-based vaccines are the most conspicuous successes. They include the vaccines approved for use against COVID-19, of course, as well as the more recent vaccines approved for use against respiratory…

Continue Reading mRNA Vaccines and Therapeutics Combine Power and Finesse

Genome Editing Market revenue to hit USD 69.6 Billion by

New York, Nov. 14, 2023 (GLOBE NEWSWIRE) — The global genome editing market size is slated to expand at ~21.1% CAGR between 2024 and 2036. The market is poised to garner a revenue of USD 69.6 billion by the end of 2036, up from a revenue of ~USD 7 billion…

Continue Reading Genome Editing Market revenue to hit USD 69.6 Billion by

Whole genome sequencing in high-grade cervical intraepitheli… : Medicine

1. Introduction Cervical cancer (CC) is the third most common cancer in women worldwide and has a high mortality rate among women. In 2008, CC was responsible for 275,000 deaths, thereby being the fourth leading cause of cancer death in females worldwide.[1,2] In China, CC is the second most…

Continue Reading Whole genome sequencing in high-grade cervical intraepitheli… : Medicine

X4 Pharmaceuticals outlines plans for drug candidate mavorixafor, eyes Q2 2024 launch By Investing.com

© Reuters. X4 Pharmaceuticals (NASDAQ:), during its third-quarter financial and operating results conference call, revealed that the FDA has accepted its New Drug Application (NDA) for mavorixafor, a leading drug candidate for the treatment of WHIM syndrome. The company is preparing for a potential US launch in Q2 2024, subject…

Continue Reading X4 Pharmaceuticals outlines plans for drug candidate mavorixafor, eyes Q2 2024 launch By Investing.com

DNA microarray technique for infectious disease diagnostics.

Introduction Infectious diseases are illnesses caused by pathogenic microbes such as bacteria, viruses, parasites, or fungus, which can be transmitted directly or indirectly from one person to another.1 Throughout human history, infectious illnesses have been a major cause of morbidity and mortality. One-third of all death worldwide is caused by…

Continue Reading DNA microarray technique for infectious disease diagnostics.

Most large structural variants in cancer genomes can be detected without long reads

JaBbA v1 outperforms previous CN algorithms We enhanced our previous JaBbA (v0.1; ref. 4) model with several methodological innovations to increase robustness to read depth waviness, improve algorithm convergence and enforce junction balance for allele-specific as well as total CN (Extended Data Fig. 1a–d and Methods). We also rigorously defined…

Continue Reading Most large structural variants in cancer genomes can be detected without long reads

Eight biotech companies tackling infectious diseases head-on

Infectious diseases are diseases that are caused by pathogens that enter the body, hijack the body’s immune system and multiply, causing an infection. Five of the deadliest infectious diseases are measles, tuberculosis, malaria, diarrhoeal disease and influenza, according to the World Economic Forum. While Our World in Data statistics suggest…

Continue Reading Eight biotech companies tackling infectious diseases head-on

What Is The Purpose Of Recombinant DNA Technology

Definition and Overview of Recombinant DNA Technology Recombinant DNA technology, also known as genetic engineering or gene splicing, is a groundbreaking scientific technique that involves the manipulation and combination of genetic material from different sources. This technology allows scientists to modify and transfer genes between organisms, creating new genetic combinations…

Continue Reading What Is The Purpose Of Recombinant DNA Technology

Posts Falsely Claim FDA ‘Required’ to Take mRNA COVID-19 Vaccines Off Market Due to Adulteration

SciCheck Digest As with many medical products, the mRNA COVID-19 vaccines may contain trace amounts of residual DNA from the manufacturing process. It is not considered adulteration, and the Food and Drug Administration is not “required” to pull the vaccines from the market, contrary to viral claims online. How do…

Continue Reading Posts Falsely Claim FDA ‘Required’ to Take mRNA COVID-19 Vaccines Off Market Due to Adulteration

papain family cysteine protease containing protein, maker-scaffold1702_size30647-snap-gene-0.14 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of papain family cysteine protease containing protein vs. L. salmonis genes Match: EMLSAG00000006045 (supercontig:LSalAtl2s:LSalAtl2s327:400616:404607:-1 gene:EMLSAG00000006045 transcript:EMLSAT00000006045 description:”augustus_masked-LSalAtl2s327-processed-gene-4.0″) HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0Identity = 283/525 (53.90%), Postives = 368/525 (70.10%), Query Frame = 0 Query: 49 GHVARPLGKSPPNFVRDPPPRTTPPAQWLWNNVNETNFLTVSRNQHLPTYCGSCWAHAATSSLSDRIKIARQGAWPDINLAPQVLISCGPGDGCHGGEAGDANAYMHAQGITDETCSIYRARGQDNGLPCSKLEICSTCE—SKCYQPQHFFTYRVDEFHDVEGESNGEQEANMMAEIHHRGPISCGIAVTQALV-NYTGGLFHDKTGAQEIDHDISVVGYGVDEGTQEKYWLIRNSWGTYWGEQGFFRLIRGVNNLGIESGTCSWATPADTWSDAARE—RAAILSNEITLQKP——LWKQLWTVVADFVDNTRDTDLFRRLKLMQKGCKKLSSPRVPVVNIRPRPQDYVSTADLPEALDWRSVNGTNFLSWSVNQHLPVYCGSCWAQAGLSSLADRFTIADRKRFANLALSVQYILNCQAGGSCHGGDAFPLYAFIQKQGVPDVTCQPYEALDEGPLTDCSKPSKLVCKDCTWPPPEPGQEGNCWAKEKFHRYYVDEYNGVEGADNMKKEILERGPVT 560 GH+ R G+…

Continue Reading papain family cysteine protease containing protein, maker-scaffold1702_size30647-snap-gene-0.14 (gene) Tigriopus kingsejongensis

Experts say there’s no evidence that the mRNA COVID-19 vaccines are ‘adulterated’

Vaccines contaminated with undisclosed ingredients. Manufacturers facing liability. In an Oct. 21 thread on X, entrepreneur and anti-vaccine activist Steve Kirsch made alarming allegations about mRNA COVID-19 vaccines. “You can now sue the mRNA COVID vaccine manufacturers for damages and the FDA is required to take the COVID vaccines off…

Continue Reading Experts say there’s no evidence that the mRNA COVID-19 vaccines are ‘adulterated’

Transgenic expression in zebrafish embryos with an intact chorion by electroporation and microinjection

Biotechnol Rep (Amst). 2023 Dec; 40: e00814. Nusrat Tazin aDepartment of Electrical and Computer Engineering, University of Utah, Salt Lake City, UT, USA Christopher Jordon Lambert bDepartment of Mechanical Engineering, University of Utah, Salt Lake City, Utah, USA Raheel Samuel bDepartment of Mechanical Engineering, University of Utah, Salt Lake City,…

Continue Reading Transgenic expression in zebrafish embryos with an intact chorion by electroporation and microinjection

Experts rebut claims that mRNA COVID-19 vaccines are ‘adulterated’

Vaccines contaminated with undisclosed ingredients. Manufacturers facing liability. In an Oct. 21 thread on X, entrepreneur and anti-vaccine activist Steve Kirsch made alarming allegations about mRNA COVID-19 vaccines.  “You can now sue the mRNA COVID vaccine manufacturers for damages and the FDA is required to take the COVID vaccines off…

Continue Reading Experts rebut claims that mRNA COVID-19 vaccines are ‘adulterated’

T cell receptor therapeutics: immunological targeting of the intracellular cancer proteome

Hedrick, S. M., Cohen, D. I., Nielsen, E. A. & Davis, M. M. Isolation of cDNA clones encoding T cell-specific membrane-associated proteins. Nature 308, 149–153 (1984). Article  CAS  PubMed  Google Scholar  Yanagi, Y. et al. A human T cell-specific cDNA clone encodes a protein having extensive homology to immunoglobulin chains….

Continue Reading T cell receptor therapeutics: immunological targeting of the intracellular cancer proteome

PLA2G7 gene polymorphism in gestational diabetes mellitus

Introduction Gestational diabetes mellitus (GDM) is a general term for abnormal glucose tolerance, abnormal fasting blood glucose, and diabetes detected or developed during pregnancy, excluding diabetes that already existed before pregnancy. According to the International Diabetes Federation, the global prevalence of GDM in 2021 was approximately 16.7% and has become…

Continue Reading PLA2G7 gene polymorphism in gestational diabetes mellitus

DNA Diagnostics Market for Non-Invasive Cancer Detection is poised to reach a projected US$ 51.5 Billion by 2032, according to FMI

The healthcare and genetics industries have seen a major shift because to the DNA diagnostics market, which has completely changed how we identify, treat, and comprehend a wide range of illnesses and ailments. With the development of technology and our understanding of genetics, this quickly expanding industry has expanded to…

Continue Reading DNA Diagnostics Market for Non-Invasive Cancer Detection is poised to reach a projected US$ 51.5 Billion by 2032, according to FMI

PDS0101 and CRT Displays Encouraging Early Data in Cervical Cancer

gynecologic cancer, cervical cancer: © tom – stock.adobe.com The combination of PDS0101 with standard-of-care (SOC) chemoradiotherapy (CRT) was associated with a rapid decline in human papillomavirus (HPV) circulating cell-free DNA (cfHPV-DNA), suggesting a potential predictive biomarker of treatment response, according to findings from the phase 2 IMMUNOCERV clinical trial (NCT04580771).1…

Continue Reading PDS0101 and CRT Displays Encouraging Early Data in Cervical Cancer

Cervical cancer could be diagnosed earlier with new DNA biosensor

Cervical cancer is the fourth most common cancer among women globally. Each year in the United States, about 11,500 new cases of cervical cancer are diagnosed with approximately 4,000 women die of this cancer. In addition, women living with HIV are 6 times more likely to develop cervical cancer compared to women…

Continue Reading Cervical cancer could be diagnosed earlier with new DNA biosensor

Ministry changes standard for cervical cancer examination to HPV DNA

Jakarta (ANTARA) – The Indonesian Health Ministry has changed the standard for cervical cancer examination, which originally used the Human Papillomavirus Virus (HPV) test with the HPV DNA method. “Starting this year, we are using HPV DNA as a standard for cervical cancer examination,” Health Minister Budi Gunadi Sadikin stated…

Continue Reading Ministry changes standard for cervical cancer examination to HPV DNA

What Is the Future for Multicancer Early Detection Tests?

PARIS — Multicancer early detection blood (MCED) tests are the focus of intensive development. What techniques do these tests use? What potential do they show? Suzette Delaloge, MD, MSc, oncologist, breast cancer specialist, and director of the individualized cancer prevention program (Interception) at the Gustave Roussy Institute in Villejuif, France,…

Continue Reading What Is the Future for Multicancer Early Detection Tests?

PDS Biotech – PDS Biotech Announces PDS0101 Combined with Chemoradiotherapy Associated with Rapid Decline in Circulating Tumor DNA (ctDNA/cfDNA)

Study evaluated levels of circulating cell-free HPV DNA (cfDNA) in patients with locally advanced cervical cancer in the IMMUNOCERV Phase 2 clinical trial and patients receiving standard of care (SOC) treatment Patients treated with PDS0101 had greater clearance of cfDNA as compared to those treated with SOC (at week 5,…

Continue Reading PDS Biotech – PDS Biotech Announces PDS0101 Combined with Chemoradiotherapy Associated with Rapid Decline in Circulating Tumor DNA (ctDNA/cfDNA)

The potential use of bacteria and bacterial derivatives as drug delivery systems for viral infection | Virology Journal

Novel approaches to treating viral illnesses must be developed. Drug delivery methods based on nanomaterials are attractive options in the search for therapeutic advantages because of their distinctive properties. Researchers should also examine how the most prevalent viruses, such as the flu, HIV, SARS-CoV-2, monkeypox, and HPVs, are being treated…

Continue Reading The potential use of bacteria and bacterial derivatives as drug delivery systems for viral infection | Virology Journal

PDS Biotechs PDS0101 Shows Promising Results in Treating Locally Advanced Cervical Cancer

On October 2, 2023, PDS Biotech shared groundbreaking findings from their IMMUNOCERV Phase 2 clinical trial. This trial focused on the potential of PDS0101, in combination with standard-of-care chemoradiotherapy (CRT), to treat locally advanced cervical cancer. The study specifically examined the levels of circulating cell-free HPV DNA (cfDNA) in patients…

Continue Reading PDS Biotechs PDS0101 Shows Promising Results in Treating Locally Advanced Cervical Cancer

PDS Biotech Announces PDS0101 Combined with

Study evaluated levels of circulating cell-free HPV DNA (cfDNA) in patients with locally advanced cervical cancer in the IMMUNOCERV Phase 2 clinical trial and patients receiving standard of care (SOC) treatment Patients treated with PDS0101 had greater clearance of cfDNA as compared to those treated with SOC (at week 5,…

Continue Reading PDS Biotech Announces PDS0101 Combined with

The Clinical Impact of mNGS for the Diagnosis of PJI

Introduction The total number of periprosthetic joint infection cases is increasing with the surging numbers of joint arthroplasties, internal fixation implantation and the use of immunosuppressive agents.1,2 Unfortunately, the identification of corresponding pathogens remains time-consuming and challenging because of inert bacteria, biofilm formation and prior antibiotic administration.3–8 Metagenomic next-generation sequencing…

Continue Reading The Clinical Impact of mNGS for the Diagnosis of PJI

Scientific Publications – Hokkaido System Science Co.,Ltd.

List of publications in which HSS NGS services were used is available as noted below. De Novo Genomic Analysis Draft genome sequence of Veillonella tobetsuensis ATCC BAA-2400T isolated from human tongue biofilm.Izumi Mashima, Futoshi NakazawaGenome Announc. 3.4 (2015): e00808-15. Genome sequence of the multiple-β-lactam-antibiotic-resistant bacterium Acidovorax sp. strain MR-S7.Takamasa Miura, Hiroyuki Kusada, Yoichi Kamagata, Satoshi…

Continue Reading Scientific Publications – Hokkaido System Science Co.,Ltd.

HPV Circulating Cell-Free DNA Kinetics in Cervical Cancer Patients Undergoing Definitive Chemoradiation

Author links open overlay panelA. Seo 1, W. Xiao 2, O. Gjyshi 1, K. Court 1, T. Cisneros Napravnik 1, A. Venkatesan 3, E.J. Lynn 1, J. Sammouri 1, L. Colbert 1, A. Jhingran 1, M.M. Joyner 1, L.L. Lin 1, M. Gillison 2, A.H. Klopp 1 Show more doi.org/10.1016/j.ijrobp.2023.06.218Get…

Continue Reading HPV Circulating Cell-Free DNA Kinetics in Cervical Cancer Patients Undergoing Definitive Chemoradiation

Molecular classification of hormone receptor-positive HER2-negative breast cancer

Siegel, R. L., Miller, K. D. & Jemal, A. Cancer statistics, 2020. CA Cancer J. Clin. 70, 7–30 (2020). Article  PubMed  Google Scholar  Huppert, L. A., Gumusay, O., Idossa, D. & Rugo, H. S. Systemic therapy for hormone receptor-positive/human epidermal growth factor receptor 2-negative early stage and metastatic breast cancer….

Continue Reading Molecular classification of hormone receptor-positive HER2-negative breast cancer

Bioinformatics Market Size is Projected to Hit 24.07 Bn by 2028, With at a 12.1% CAGR by 2022-2028 | Brandessence Market Research

LONDON , Sept. 26, 2023 /PRNewswire/ — According to a comprehensive research report by Brandessence Market Research (BMRC), “Bioinformatics Market Size, Share, And Trends Analysis Report By Product (Sequence Analysis Platform, Sequence Alignment Platforms, Structural & Functional Analysis Platforms, Sequence Manipulation Platforms), By Application (Drug Development, Protein Function Analysis, Gene Therapy,…

Continue Reading Bioinformatics Market Size is Projected to Hit 24.07 Bn by 2028, With at a 12.1% CAGR by 2022-2028 | Brandessence Market Research

ncRNA | Free Full-Text | The Intergenic Type lncRNA (LINC RNA) Faces in Cancer with In Silico Scope and a Directed Lens to LINC00511: A Step toward ncRNA Precision

CRC Upregulated 153-5p HIF-1 activates LINC00511, targeting HIF-1’s 3-UTR and +ve feedback loop [78] Oncogene Human CRC tissues vs. paired adjacent non-tumor and CRC cell lines HT29, LOVO, SW620, SW480 vs. normal colon epithelial FHC cell line and athymic BALB/c nude mice for implantation – HNF4 promotes LINC00511 transcription, interaction…

Continue Reading ncRNA | Free Full-Text | The Intergenic Type lncRNA (LINC RNA) Faces in Cancer with In Silico Scope and a Directed Lens to LINC00511: A Step toward ncRNA Precision

A CRISPR-Cas12a-based platform facilitates the detection and serotyping of Streptococcus suis serotype 2

Streptococcus suis is a facultative anaerobic Gram-positive bacterium responsible for substantial economic losses in the worldwide swine industry. It can cause meningitis, septicemia, endocarditis, and sudden death in pigs. The bacterium can colonize the tonsil and nasal cavities of healthy pigs, with single or multiple serotypes possible in an individual…

Continue Reading A CRISPR-Cas12a-based platform facilitates the detection and serotyping of Streptococcus suis serotype 2

Targeting HPV to prevent cancer

Phylogenetic Analysis of select Papillomavirus found in the cohort. HPV DNA sequences for each papillomavirus were obtained from PAVE and used for MEGA analysis. The resulting multiple alignments were then used to generate a phylogenetic tree to analyze the evolutionary patterns of select papillomavirus. Clades were identified related to the…

Continue Reading Targeting HPV to prevent cancer

Identify genes for mapped reads with combined human-7HPV genome index

Hi, I have created a combined genome index with a human genome and 7 HPV genomes. I am running STAR aligner against this index with a number of cancer samples. From the idxstats file, I can see some mapped reads for a particular HPV chromosome: M14119.1 7931 6 0 If…

Continue Reading Identify genes for mapped reads with combined human-7HPV genome index

A global health problem

Together, Dom-Chima and Biswas obtained 90 cervical samples and spent six months processing samples using next-generation DNA sequencing to identify multiple HPV types in samples. Type-specific PCR analysis was then used to verify the HPV types circulating in Nigeria. Their research found strikingly high rates of multiple HPV infections in…

Continue Reading A global health problem

ncRNA | Free Full-Text | The Potential microRNA Prognostic Signature in HNSCCs: A Systematic Review

Jung et al., 2012 [24] USA RT 17 OSCC (Tongue base 6, Tongue anterior 3, Tongue border 2, Tongue ventral, Mouth 1, Oropharynx 1, Tongue unspecified 2) miR-7, miR-21, miR-424 180 17 Ma 34–81 \ \ HPV +10, −7 pTNM stage I 1, II 5, IV 8, 3 N\A Kawakita…

Continue Reading ncRNA | Free Full-Text | The Potential microRNA Prognostic Signature in HNSCCs: A Systematic Review

Promising new cervical cancer test fills in the gap missed by Pap tests

In a recent study published in the Journal of the National Cancer Institute, researchers assessed a novel human papillomavirus (HPV) and host deoxyribonucleic acid (DNA) methylation score for adenocarcinoma in-situ (AIS) and cervical adenocarcinoma (ADC) screening. Study: A novel human papillomavirus and host DNA methylation score and detection of cervical…

Continue Reading Promising new cervical cancer test fills in the gap missed by Pap tests

DNA Therapy Gets Breakthrough Status for Recurrent Respiratory Papillomatosis

The Food and Drug Administration (FDA) has granted Breakthrough Therapy designation to INO-3107 for the treatment of recurrent respiratory papillomatosis. Recurrent respiratory papillomatosis (RRP) is caused primarily by human papillomavirus (HPV) types 6 and 11. It is characterized by the development of small, noncancerous papillomas in the respiratory tract that…

Continue Reading DNA Therapy Gets Breakthrough Status for Recurrent Respiratory Papillomatosis

Equitable access to HPV vaccines, screening needed

COMMENT | I warmly welcomed delegates to the Global HPV Consortium launch in Kuala Lumpur yesterday. The consortium is a public-private movement to prevent Human Papillomavirus (HPV) infection and eliminate cervical cancer, by far the most common HPV-related disease, as a public health concern. It brought together stakeholders from Malaysia,…

Continue Reading Equitable access to HPV vaccines, screening needed

X4 Pharmaceuticals Announces Submission of New Drug Application (NDA) to U.S. FDA for Mavorixafor in WHIM Syndrome | Small Molecules

X4 Pharmaceuticals Announces Submission of New Drug Application (NDA) to U.S. FDA for Mavorixafor in WHIM Syndrome Details Category: Small Molecules Published on Tuesday, 05 September 2023 18:24 Hits: 139 Submission supported by positive results from global, pivotal 4WHIM Phase 3 clinical trial BOSTON, MA, USA I September 05,…

Continue Reading X4 Pharmaceuticals Announces Submission of New Drug Application (NDA) to U.S. FDA for Mavorixafor in WHIM Syndrome | Small Molecules

GARDASIL 9 Shows Positive Results in Phase 3 Study Against HPV-Related Cancers

Results of a phase 3 trial of GARDASIL9 (Human Papillomavirus 9-valent Vaccine, Recombinant) in patients aged 9 to 15 years old, have been published in the journal Pediatrics.1 GARDASIL 9 is a vaccine developed to prevent cancers caused by multiple human papillomavirus (HPV) types inindividuals aged 9 to 45 years….

Continue Reading GARDASIL 9 Shows Positive Results in Phase 3 Study Against HPV-Related Cancers

The global bone cancer treatment market size was valued at USD 2.1 billion in 2023 and is projected to reach USD 2.9 billion by 2030, exhibiting a CAGR of 5.2% from 2023 to 2030.

PRESS RELEASE Published August 25, 2023 List of reports available with us. Bone Cancer Treatment Market Size / CAGR / Sales Revenue   (Request Free Sample Report) Cervical Cancer Market Size / CAGR / Sales Revenue   (Request Free Sample Report) Cervical Cancer Vaccine Market Size / CAGR / Sales Revenue   (Request…

Continue Reading The global bone cancer treatment market size was valued at USD 2.1 billion in 2023 and is projected to reach USD 2.9 billion by 2030, exhibiting a CAGR of 5.2% from 2023 to 2030.

Gut Microbiota Metabolites Mediate Bax to Reduce Neuronal Apoptosis via cGAS/STING Axis in Epilepsy

Zack MM, Kobau R (2017) National and state estimates of the numbers of adults and children with active epilepsy – United States, 2015. MMWR Morb Mortal Wkly Rep 66:821–825. doi.org/10.15585/mmwr.mm6631a1 Article  PubMed  PubMed Central  Google Scholar  Pottoo F et al (2020) Impact of adherence to antiepileptic medications on quality of…

Continue Reading Gut Microbiota Metabolites Mediate Bax to Reduce Neuronal Apoptosis via cGAS/STING Axis in Epilepsy

PDS Biotechnology (PDSB) Announces Submission of Phase 3 Protocol to FDA to Initiate VERSATILE-003 Trial

PDS Biotechnology Corporation (Nasdaq: PDSB) (PDS Biotech or the Company), a clinical-stage immunotherapy company developing a growing pipeline of targeted cancer immunotherapies and infectious disease vaccines based on the Company’s proprietary T cell activating platforms, today announced the submission to the U.S. Food and Drug Administration (FDA) of an updated…

Continue Reading PDS Biotechnology (PDSB) Announces Submission of Phase 3 Protocol to FDA to Initiate VERSATILE-003 Trial

PDS Biotech Announces Submission of Phase 3 Protocol to FDA

VERSATILE-003 will evaluate PDS0101 in combination with KEYTRUDA® in recurrent or metastatic HPV16-positive head and neck cancer PDS Biotech anticipates initiating the VERSATILE-003 trial in the fourth quarter of 2023 PRINCETON, N.J., Aug. 14, 2023 (GLOBE NEWSWIRE) — PDS Biotechnology Corporation (Nasdaq: PDSB) (PDS Biotech or the Company), a clinical-stage…

Continue Reading PDS Biotech Announces Submission of Phase 3 Protocol to FDA

PDS Biotech Reports Second Quarter 2023 Financial Results and Provides Business Update

PDS Biotechnology Corporation Successful submission of final clinical protocol and supporting CMC information to FDA to initiate Phase 3 VERSATILE-003 trial in the fourth quarter 2023 Biomarker data from VERSATILE-002 to be presented at ESMO 2023 Company to host conference call and webcast today at 8:00 AM EDT PRINCETON, N.J.,…

Continue Reading PDS Biotech Reports Second Quarter 2023 Financial Results and Provides Business Update

Real-Time Pcr (Qpcr), Endpoint Pcr, And Dpcr Market Trends, Growth, & Share-2031

(MENAFN– Straits Research) Real-time PCR, or quantitative PCR, is an established method for sensitive and rapid nucleic acid quantification in various biological samples. Real-time PCR, or quantitative PCR, is an established method for sensitive and rapid nucleic acid quantification in various biological samples. Endpoint PCR, also known as conventional PCR,…

Continue Reading Real-Time Pcr (Qpcr), Endpoint Pcr, And Dpcr Market Trends, Growth, & Share-2031

Molecular Diagnostics Market to Witness Promising CAGR Growth of 13.3% by 2030, Size, Share, Trends, Demand, Revenue and Segmentation Outlook

The growing incidence of infectious diseases and cancer globally has increased the adoption of molecular diagnostics. The major market players are now primarily focused on technological advances in molecular diagnostics. Also, it has been witnessed during COVID-19 that the diagnostics industry faced much growth, with a race to develop novel…

Continue Reading Molecular Diagnostics Market to Witness Promising CAGR Growth of 13.3% by 2030, Size, Share, Trends, Demand, Revenue and Segmentation Outlook

Development of peptide nucleic acid-based bead array technology for Bacillus cereus detection

Zhang, Z. et al. Detection of viable enterotoxin-producing Bacillus cereus and analysis of toxigenicity from ready-to-eat foods and infant formula milk powder by multiplex PCR. J. Dairy Sci. 99, 1047–1055 (2016). Article  CAS  PubMed  Google Scholar  Rahnama, H., Azari, R., Hashem, M. & Berizi, E. A systematic review and meta-analysis…

Continue Reading Development of peptide nucleic acid-based bead array technology for Bacillus cereus detection

Cervical screening using HPV-DNA cytology in a low-income setting: an audit within a socio-economically deprived rural community in the Philippines

Cervical cancer (CC) is the fourth most diagnosed cancer and the fourth leading cause of cancer death among women globally.1 In the Philippines, CC is the second leading cause of cancer in women. In 2018 there were 9.1% new CC cases in the Philippines, compared to 0.47% new cases in…

Continue Reading Cervical screening using HPV-DNA cytology in a low-income setting: an audit within a socio-economically deprived rural community in the Philippines

Recbio shingles vaccine clinical trial approved

Jiangsu Recbio Technology Co., Ltd. has received notice of acceptance from China’s National Medical Products Administration (NMPA) to start a clinical trial for its self-developed novel adjuvanted recombinant shingles vaccine, REC610.  Within 60 days from the date of acceptance, the company may carry out clinical trials in accordance with the…

Continue Reading Recbio shingles vaccine clinical trial approved

Uruguay needs to strengthen screening awarene

image: ¿A qué edad se hizo su primera prueba de detección de cáncer de cuello uterino? view more  Credit: BGI Genomics Research from the Registro Nacional de Cáncer notes that Uruguay has the highest cancer incidence and mortality rates in Latin America. In particular, cervical cancer is the third leading cause…

Continue Reading Uruguay needs to strengthen screening awarene

New Progress Using Liquid Biopsies to Analyze cfDNA for Endometrial and Cervical Cancers

Liquid biopsies have the potential to revolutionize cancer diagnosis and treatment decisions. Unlike biopsies that require removing tumor tissue, these tests use a simple blood draw to assess the molecular characteristics of cancer. Liquid biopsies can be done repeatedly and quickly, offering researchers a less invasive way to detect cancer…

Continue Reading New Progress Using Liquid Biopsies to Analyze cfDNA for Endometrial and Cervical Cancers

Welcome development: on the ICMR and Controlled Human Infection Studies

With the Bioethics Unit of the Indian Council of Medical Research (ICMR) placing a consensus policy statement on Controlled Human Infection Studies (CHIS) for comments, India has taken the first step in clearing the deck for such studies to be undertaken here. CHIS, also called human challenge studies, where healthy…

Continue Reading Welcome development: on the ICMR and Controlled Human Infection Studies

The potential role of the microbiota in prostate cancer pathogenesis and treatment

Lynch, S. V. & Pedersen, O. The human intestinal microbiome in health and disease. N. Engl. J. Med. 375, 2369–2379 (2016). Article  CAS  PubMed  Google Scholar  Qin, J. et al. A human gut microbial gene catalogue established by metagenomic sequencing. Nature 464, 59–65 (2010). Article  CAS  PubMed  PubMed Central  Google…

Continue Reading The potential role of the microbiota in prostate cancer pathogenesis and treatment

How to Detect Presence of HPV-33 in Sample Data (FASTQ, BAM, VCF on GRCh37)

How to Detect Presence of HPV-33 in Sample Data (FASTQ, BAM, VCF on GRCh37) 2 Hello everyone, I have a tissue sample for which I have sequencing data available in several formats – FASTQ, BAM, and VCF. The alignment has been done against the GRCh37 reference genome. I am interested…

Continue Reading How to Detect Presence of HPV-33 in Sample Data (FASTQ, BAM, VCF on GRCh37)

A systems biology approach to pathogenesis of gastric cancer: gene network modeling and pathway analysis | BMC Gastroenterology

In recent years, different investigations in the area of multi-center genomics research from gene to systems level and next-generation sequencing, clarified the various mechanisms specifically involved in the tumor progression [29]. This study used bioinformatics analysis to further investigate the genes involved in GC pathogenesis. In addition, the current study…

Continue Reading A systems biology approach to pathogenesis of gastric cancer: gene network modeling and pathway analysis | BMC Gastroenterology

The R&D landscape for infectious disease vaccines

Vaccines have a tremendous impact on public health, and their importance has been emphasized by the COVID-19 pandemic. Here, we provide an overview of the current state of research and development (R&D) on prophylactic vaccine candidates for infectious diseases globally. Technology platforms As of 1 January 2023, the global vaccine…

Continue Reading The R&D landscape for infectious disease vaccines

IJMS | Free Full-Text | DNA Methylation in the Fields of Prenatal Diagnosis and Early Detection of Cancers

1. DNA Methylation: Looking Back over the Century “Genes are equivalent to blueprints; epigenetics is the contractor. They change the assembly, the structure.” —Bruce Lipton. The methylation of the DNA is a quintessential epigenetic mechanism consisting of the binding of a methyl group to the fifth carbon of the cytosine…

Continue Reading IJMS | Free Full-Text | DNA Methylation in the Fields of Prenatal Diagnosis and Early Detection of Cancers

Merck Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival in Patients with Newly Diagnosed High-Risk Locally Advanced Cervical Cancer

RAHWAY – Merck (NYSE: MRK), known as MSD outside of the United States and Canada, today announced that the Phase 3 KEYNOTE-A18 trial, also known as ENGOT-cx11/GOG-3047, investigating KEYTRUDA, Merck‘s anti-PD-1 therapy, in combination with external beam radiotherapy (EBRT) plus concurrent chemotherapy, followed by brachytherapy (also known as concurrent chemoradiotherapy)…

Continue Reading Merck Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival in Patients with Newly Diagnosed High-Risk Locally Advanced Cervical Cancer

Merck Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival (PFS) in Patients With Newly Diagnosed High-Risk Locally Advanced Cervical Cancer

KEYTRUDA® (pembrolizumab) plus concurrent chemoradiotherapy demonstrated statistically significant and clinically meaningful improvement in PFS versus concurrent chemoradiotherapy alone in these patients RAHWAY, N.J.–(BUSINESS WIRE)–Merck (NYSE: MRK), known as MSD outside of the United States and Canada, today announced that the Phase 3 KEYNOTE-A18 trial, also known as ENGOT-cx11/GOG-3047, investigating KEYTRUDA,…

Continue Reading Merck Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival (PFS) in Patients With Newly Diagnosed High-Risk Locally Advanced Cervical Cancer

Merck Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival (PFS) in Patients With Newly Diagnosed High-Risk Locally Advanced Cervical Cancer | Antibodies

Merck Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival (PFS) in Patients With Newly Diagnosed High-Risk Locally Advanced Cervical Cancer Details Category: Antibodies Published on Wednesday, 19 July 2023 18:10 Hits: 115 KEYTRUDA® (pembrolizumab) plus concurrent chemoradiotherapy demonstrated statistically significant and clinically meaningful improvement in PFS versus…

Continue Reading Merck Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival (PFS) in Patients With Newly Diagnosed High-Risk Locally Advanced Cervical Cancer | Antibodies

Merkel Cell Carcinoma Virus Hijacks Host Cell Replication

Credit: fatido/Getty Images The Merkel cell polyomavirus (MCV), usually harmless in most infected people, causes an aggressive skin cancer called Merkel cell carcinoma in about 3,000 people each year. New research published in PNAS from the University of Pittsburgh reveals the first steps explaining how the virus outpaces replication of…

Continue Reading Merkel Cell Carcinoma Virus Hijacks Host Cell Replication

Merck (MRK) Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival (PFS)

Merck (NYSE: MRK), known as MSD outside of the United States and Canada, today announced that the Phase 3 KEYNOTE-A18 trial, also known as ENGOT-cx11/GOG-3047, investigating KEYTRUDA, Merck’s anti-PD-1 therapy, in combination with external beam radiotherapy (EBRT) plus concurrent chemotherapy, followed by brachytherapy (also known as concurrent chemoradiotherapy) met one…

Continue Reading Merck (MRK) Announces Phase 3 KEYNOTE-A18 Trial Met Primary Endpoint of Progression-Free Survival (PFS)

Cervical carcinogenesis risk association of HPV33 E6 and E7 genetic variations in Taizhou, Southeast China | Virology Journal

Characteristics of the study population From February 2014 to December 2020, a total of 189 women with a single HPV33 infection were selected. The average age was 42.3 years (range 19–73 years). A total of 185 (97.9%) sequences of the entire E6 and E7 genes from HPV33 were successfully obtained….

Continue Reading Cervical carcinogenesis risk association of HPV33 E6 and E7 genetic variations in Taizhou, Southeast China | Virology Journal

Vasso’s Corner: mRNA, DNA, vector, protein, attenuated, inactivated vaccines: What’s the difference?

Since the COVID-19 pandemic we constantly hear mRNA-, viral vector-, DNA-, protein-, killed- and, live attenuated- based vaccines. What is the difference? They are just different types of vaccine formulations, all with the same end-result, to stimulate an immune response and protect against a specific disease. History of vaccines: The…

Continue Reading Vasso’s Corner: mRNA, DNA, vector, protein, attenuated, inactivated vaccines: What’s the difference?

Pap Tests to Contribute the Most to HPV Testing and Pap Test Market throughout the Analysis Period, States Future Market Insights

According to Future Market Insights (FMI) in a recent market analysis, the Global HPV testing and Pap Test Market Size was valued at US$ 2.2 billion in 2021 and is predicted to reach US$ 15 billion by 2032. According to the report’s findings, Pap Testing will continue to be crucial…

Continue Reading Pap Tests to Contribute the Most to HPV Testing and Pap Test Market throughout the Analysis Period, States Future Market Insights

Rapid and sensitive Cas12a-based one-step nucleic acid detection with ssDNA-modified crRNA,Analytica Chimica Acta

CRISPR-Cas12a RNA-guided complexes have been developed to facilitate the rapid and sensitive detection of nucleic acids. However, they are limited by the complexity of the operation, risk of carry-over contamination, and degradation of CRISPR RNA (crRNA). In this study, a Cas12a-based single-stranded DNA (ssDNA)-modified crRNA (mD-crRNA)-mediated one-step diagnostic method (CasDOS)…

Continue Reading Rapid and sensitive Cas12a-based one-step nucleic acid detection with ssDNA-modified crRNA,Analytica Chimica Acta

Limited Data Available on HPV Vaccine Immunogenicity, Efficacy in People Living With HIV

Despite people living with HIV (PLH) being a high-priority group for the human papillomavirus (HPV) vaccine, limited data are available on its long-term immunogenicity and efficacy within this population, according to a review published in Vaccines. Researchers noted that PLH are more vulnerable to HPV and related diseases, making them…

Continue Reading Limited Data Available on HPV Vaccine Immunogenicity, Efficacy in People Living With HIV

Prevalence of five treatable sexually transmitted infections among women in Lower River region of The Gambia | BMC Infectious Diseases

Rowley J, Hoorn S, Vander, Korenromp E, Low N, Unemo M, Abu-Raddad LJ, et al. Chlamydia, gonorrhoea, trichomoniasis and syphilis: global prevalence and incidence estimates, 2016. Bull World Health Organ. 2019;97(8):548–62. Article  PubMed  PubMed Central  Google Scholar  Van Gerwen OT, Muzny CA, Marrazzo JM. Sexually transmitted infections and female reproductive…

Continue Reading Prevalence of five treatable sexually transmitted infections among women in Lower River region of The Gambia | BMC Infectious Diseases

Human papillomavirus spectrum of HPV-infected women in Nigeria: an analysis by next-generation sequencing and type-specific PCR | Virology Journal

Our goal in this study was to determine the diversity and prevalence of HPV types in Nigeria using DNA amplification and sequencing. The samples were collected and transported using a simplified FTA card protocol (GE Life Sciences, Piscataway, NJ) methodology. RCA amplified the DNA samples. The amplified DNA was analyzed…

Continue Reading Human papillomavirus spectrum of HPV-infected women in Nigeria: an analysis by next-generation sequencing and type-specific PCR | Virology Journal

HPV Tumor DNA Liquid Biopsy Test Shows Promise for Oropharyngeal Cancer Diagnosis, Surveillance

NEW YORK — Researchers have determined that a liquid biopsy human papillomavirus DNA test may serve as a useful tool for the diagnosis and surveillance of HPV-associated oropharyngeal squamous cell carcinoma (OPSCC). In a paper published in JAMA Otolaryngology–Head & Neck Surgery on Monday, a team led by researchers at the Icahn School…

Continue Reading HPV Tumor DNA Liquid Biopsy Test Shows Promise for Oropharyngeal Cancer Diagnosis, Surveillance

Genotyping Market Size to Worth Around USD 67.60 Billion by

Ottawa, July 04, 2023 (GLOBE NEWSWIRE) — The genotyping market size was valued at USD 16.9 billion in 2022. The global genotyping market growth is driven by the rising prevalence of target diseases, such as cancer, Alzheimer’s, and diabetes, rising R&D expenditure for precision medicine research, increasing investment by government…

Continue Reading Genotyping Market Size to Worth Around USD 67.60 Billion by

Cigarette Smoke and HPV Synergistically Increase Head and Neck Cancer Risk

Tobacco smoking and human papillomavirus (HPV) are both well-known risk factors for head and neck cancer, but there is ample evidence to show they can interact to increase still further the risk of contracting the disease, according to a study by scientists at the University of São Paulo (USP) in…

Continue Reading Cigarette Smoke and HPV Synergistically Increase Head and Neck Cancer Risk

Branched DNA switchable CRISPR-Cas12a system for sensing FEN1 activity

The discovery of Flap endonuclease 1 (FEN1) can be traced back to the 1960 s of the last centuries, Klett et al. discovered “Exonuclease VI” while studying Escherichia coli [1]. FEN1 is a structure-specific nuclease that precisely recognizes a double-flap DNA structure consisting of unpaired 5′-overhang and a single nucleotide 3′-flap,…

Continue Reading Branched DNA switchable CRISPR-Cas12a system for sensing FEN1 activity

Postdoctoral Fellow Position in Computational Epigenomics job with H. Lee Moffitt Cancer Center & Research Institute

At Moffitt Cancer Center, we come face-to-face with cancer every day, but we also see courage. And it inspires us to be the safest and best place for cancer care – to bring greater hope to every patient we serve. It’s why we’ve been continually named One of the Top…

Continue Reading Postdoctoral Fellow Position in Computational Epigenomics job with H. Lee Moffitt Cancer Center & Research Institute

PharmaJet Tropis Intradermal Delivery System is Now Authorized for Two Nucleic Acid Vaccines

GOLDEN, Colo., June 28, 2023–(BUSINESS WIRE)–PharmaJet®, a company engineering precision delivery systems that overcome challenges of nucleic acid vaccine delivery, today announced that its Tropis® System is now the exclusive intradermal delivery system for two authorized novel Covid-19 vaccines: This press release features multimedia. View the full release here: www.businesswire.com/news/home/20230628015647/en/…

Continue Reading PharmaJet Tropis Intradermal Delivery System is Now Authorized for Two Nucleic Acid Vaccines

Vial partners with Nielsen BioSciences in phase 3 trial for common warts treatment

Vial will support Nielsen with their phase 3, randomized, double-blind, placebo-controlled clinical study of CANDIN for the treatment of Verruca vulgaris (common warts) in adolescents and adults in the US and Japan. Verruca vulgaris are benign lesions caused by infection of the skin with the human papillomavirus (HPV). They are…

Continue Reading Vial partners with Nielsen BioSciences in phase 3 trial for common warts treatment

2023 Warren Alpert Prize Honors Pioneer in Computational Biology

“At a time when computation was deemed an exotic pursuit by most biomedical researchers, David was prescient because he understood the potential of computation to propel biomedical science forward,” said George Q. Daley, dean of HMS and chair of the Warren Alpert Foundation Prize scientific advisory board. “His vision, creativity,…

Continue Reading 2023 Warren Alpert Prize Honors Pioneer in Computational Biology

KEYNOTE-826 Data Confirm Survival Benefit of Pembrolizumab Addition in Cervical Cancer

The addition of pembrolizumab (Keytruda) to chemotherapy with or without bevacizumab (Avastin) for the first-line treatment of patients with persistent, recurrent, or metastatic cervical cancer continues to demonstrate significant survival benefits, according to updated findings from the phase 3 KEYNOTE-826 trial (NCT03635567). After a median follow-up of over 3 years…

Continue Reading KEYNOTE-826 Data Confirm Survival Benefit of Pembrolizumab Addition in Cervical Cancer

Just one dose of HPV vaccine benefits women worldwide

At some point in their life, it’s estimated that around 80 per cent of people will be infected with the human papillomavirus (HPV). Although many infections will go unnoticed, some strains of HPV can damage DNA, leading to various types of cancer, including cervical, anal and oropharyngeal (throat) cancers. Some…

Continue Reading Just one dose of HPV vaccine benefits women worldwide

Applications of long-read sequencing to Mendelian genetics | Genome Medicine

Kingsmore SF, Cakici JA, Clark MM, Gaughran M, Feddock M, Batalov S, et al. A randomized, controlled trial of the analytic and diagnostic performance of singleton and trio, rapid genome and exome sequencing in ill infants. Am J Hum Genet. 2019;105(4):719–33. Article  CAS  PubMed  PubMed Central  Google Scholar  Costain G,…

Continue Reading Applications of long-read sequencing to Mendelian genetics | Genome Medicine

OICR funding to help six Ontario-based research teams improve the lives of cancer patients

Funding announced today by the Ontario Institute for Cancer Research (OICR) will help six Ontario-based research teams pursue their ultimate goal of improving the lives of people with cancer. Funding comes through OICR’s Innovation to Implementation (I2I) program, which aims to help ensure new discoveries about preventing, diagnosing and treating…

Continue Reading OICR funding to help six Ontario-based research teams improve the lives of cancer patients

Evaluating India’s journey to global vaccine dominance

By Subhasis Banerjee India’s success in the vaccine industry is deep-rooted in the country’s history of achieving excellence, long-term investment over the years and willingness to innovate. The country manufactured vaccines on a global scale and exported them to other countries while also conducting the largest vaccination in the world,…

Continue Reading Evaluating India’s journey to global vaccine dominance