Categories
Tag: IgG
16 UK biotech companies you should know about
The UK is home to several biotech hubs, including the famous ‘golden triangle’, made up of Oxford, Cambridge, and London. In fact, after a $700 million surge in funding in the third quarter of 2023, the UK biotech scene is now one of the most vibrant in Europe, laying the…
Endogenous Coriobacteriaceae enriched by a high-fat diet promotes colorectal tumorigenesis through the CPT1A-ERK axis
Bacteria Strain Cori.ST1911 was isolated from fresh stool of 20-week-old C57/BL6J mice fed a HFD at the Animal Center of the West China Hospital of Sichuan University. Briefly, faecal particles were ground with a glass grinding rod and suspended in sterile phosphate-buffered saline (PBS). After gradient dilution, the suspension was…
Proteomic analysis of SARS-CoV-2 particles unveils a key role of G3BP proteins in viral assembly
Capturing proteins associated with SARS-CoV-2 virions To identify host cell proteins potentially present in extracellular SARS-CoV-2 virions, viral particles were produced from two lung epithelial cell models, A549 cells overexpressing ACE2 receptor (A549-ACE2) and Calu-3 cells that naturally express ACE2 receptor and TMPRSS2. Following infection with the D614G SARS-CoV-2 strain32,…
Domestic pigs are susceptible to experimental infection with non-human primate-derived Reston virus without the need for adaptation
Ethics and animal welfare statement All infectious work with RESTV, including sample inactivation, was performed in the Containment Level 4 laboratory (CL4) in accordance with the policies and protocols outlined by the Canadian Science Centre for Human and Animal Health Institutional Biosafety Committee. All animal work was performed in strict…
Why Is Argenx (ARGX) Stock Down 25% Today?
Source: Wirestock Creators / Shutterstock.com Shares of biotechnology specialist Argenx (NASDAQ:ARGX) — which focuses on addressing severe autoimmune diseases – suffered a hefty decline on Wednesday following a clinical disappointment. Its Phase 3 study for a disease that causes skin blisters failed to meet its primary and secondary objectives. As…
csi-miR-96-5p delivered by Clonorchis sinensis extracellular vesicles promotes intrahepatic cholangiocarcinoma proliferation and migration via the ferroptosis-related PTEN/SLC7A11/GPX4 axis | Parasites & Vectors
Human tissue samples The preoperative diagnosis of CS mainly relies on stool microscopy, enzyme-linked immunosorbent assay, or endoscopy. Fresh liver and intrahepatic bile duct specimens were collected from ICC patients with (CS-ICC group) and without (NC-ICC group) CS infection during partial hepatectomy at the First Hospital of Jilin University. Tumor tissues…
Analysis of off-tumour toxicities of T-cell-engaging bispecific antibodies via donor-matched intestinal organoids and tumouroids
Human tissue samples Tissue samples and annotated data were obtained, and experimental procedures were performed within the framework of the non-profit foundation HTCR, including informed patient consent. Intestinal organoid and tumouroid cell culture Supplementary Table 1 provides anonymized basic donor information. After isolation of intestinal crypts following a previously described…
Preclinical assessment of an anti-HTLV-1 heterologous DNA/MVA vaccine protocol expressing a multiepitope HBZ protein | Virology Journal
Design of the recombinant virus MVA-HBZ The multiepitope protein design was based on HBZ sequence deposited in the GenBank database [17, 23, 24], and in silico analyses performed using the epitope prediction tools: NetMHCpan 4.0 (Threshold: weak binders—2.0; strong binders—0.5), NetCTL 1.2 (Threshold of 0.75) and IEDB—MHC-I Binding Predictions. Epitopes…
Evidence that human Fc gamma receptor IIA (CD32) subtypes are not receptors for oxidized LDL
Several lines of evidence suggest that clearance of oxidized LDL (oxLDL) immune complexes by macrophage IgG Fc receptors (Fc gamma Rs) plays a role in atherogenesis. Ox-LDL may also be cleared directly by Fc gamma Rs, as shown for murine Fc gamma RII-B2. In humans, the homologous Fc gamma R…
Alyglo Approved for Patients With Primary Humoral Immunodeficiency
The Food and Drug Administration (FDA) has approved GC Biopharma’s Alyglo™ (immune globulin intravenous, human-stwk) 10% liquid for the treatment of primary humoral immunodeficiency (PI) in adult patients 17 years of age and older. Manufactured from pooled human plasma from US donors, Alyglo supplies a broad spectrum of neutralizing IgG…
Gadolinium Oxide Nanoparticles reinforce immune response
Boyi Yu,1– 4 Xuanyi Lu,5 Xianglong Feng,1– 4 Ting Zhao,1– 4 Jiaxin Li,1– 4 Yudie Lu,5 Fei Ye,1– 4 Xiongxiong Liu,1– 4 Xiaogang Zheng,1– 4 Zheyu Shen,5 Xiaodong Jin,1– 4 Weiqiang Chen,1– 4 Qiang Li1– 4 1Biomedical Center, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou, People’s Republic of…
Evaluation of immunogenicity-induced DNA vaccines against different SARS-CoV-2 variants
In a recent article published in PLOS ONE, researchers designed five deoxyribonucleic acid (DNA) vaccine candidates based on different severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) strains. They evaluated the immunogenicity of each in mice. Study: Evaluation of immunogenicity-induced DNA vaccines against different SARS-CoV-2 variants. Image Credit: M-Foto/Shutterstock.com Background A safe and effective…
Thyroid hormone-regulated chromatin landscape and transcriptional sensitivity of the pituitary gland
Mouse genetic models The ThrbHAB allele expresses TRβ proteins (TRβ1 and TRβ2) fused to a peptide with a hemagglutinin (HAx2) tag and a site for biotinylation by prokaryotic BirA ligase, modified from a published tag30. The tag was inserted at the endogenous Thrb gene by homologous recombination in W9.5 (129/Sv)…
Foods | Free Full-Text | Isothermal Amplification and CRISPR/Cas12a-System-Based Assay for Rapid, Sensitive and Visual Detection of Staphylococcus aureus
1. Introduction Staphylococcus aureus [1], one of the top five foodborne pathogens, has a common and strong aggressiveness in humans and can secrete multiple toxic proteins (Pathogenic enterotoxins, Hemolysin, PVL) [1,2] which can cause bacteraemia, endocarditis, meningitis, toxic shock syndrome, pneumonia and other dangerous infectious diseases [3]. Moreover, the worldwide…
Learning from cerebrospinal fluid drug-resistant HIV escape-associated encephalitis: a case report | Virology Journal
A 27-year-old HIV-positive Chinese Manchu male complained of intermittent headache, nausea, and vomiting (non-projectile vomiting three times in total) for two weeks in January 2022. No fever, amaurosis, or unconsciousness were presented. He denied preceding travel or unusual animal exposures. He was diagnosed with HIV infection five years ago and…
Employment of a high throughput functional assay to define the critical factors that influence vaccine induced cross-variant neutralizing antibodies for SARS-CoV-2
Study design, ethical statement, and sample collection The vaccinated participants were recruited under the COVID-19 PROTECT study (2012/00917). The convalescent plasma samples were collected from subjects who were diagnosed with COVID-19 by positive polymerase chain reaction (PCR) results (study 2020/00120). All participants provided written informed consent in accordance with the…
C1 MCK2 is an inactive chemokine.
(A) HEK293 cells were transfected with pFuse vectors expressing human IgG-Fc fusion proteins of wt, C1 and 129stop MCK2. 24 hours after transfection, supernatants from transfected cells were harvested, proteins precipitated with EtOH and detected by WB using an antibody specific for human IgG. Supernatants from mock-transfected cells were used…
Body identified: Laurentian Hills body found in 2001 identified through advanced DNA testing
A man whose body was found in a remote area about 190 kilometres from Ottawa in 2001 has been identified thanks to advanced DNA testing. Police say genetic testing confirmed the body is that of a man from Drumheller, Alta. born in 1962. The man was found…
The identification of a man, whose body was discovered in a secluded region of Laurentian Hills in 2001, has been made possible through the utilization of advanced DNA testing.
Article content LAURENTIAN HILLS — The identification of a man whose body was discovered in a secluded, wooded region of Laurentian Hills in 2001, has been made possible through the utilization of advanced DNA testing. Article content On Sept. 5, 2001, members of the Upper Ottawa Valley Detachment of the…
In Vitro Diagnostics Market Size Estimated to Reach USD 124.65 Bn by 2032| Precedence Research
OTTAWA, ON, Dec. 8, 2023 /PRNewswire/ — The global in vitro diagnostics (IVD) market size is estimated to reach around USD 124.65 billion by 2032, increasing from USD 107.76 billion in 2023. The global in vitro diagnostics (IVD) market size was estimated at USD 115.48 billion in 2022 and the sector has…
Metagenomic next-gene sequencing for respiratory infections
Introduction Respiratory tract infections are common and occur frequently. Rapid and accurate microbial detection is essential for timely and appropriate treatment. Traditional microbial detection methods have some limitations such as dependence on morphology, long duration, low sensitivity, and high variability.1,2 Metagenomic next-generation sequencing (mNGS) is a new detection technology characterized…
VAX-24 Phase 1/2 Adult Proof-of-Concept Data Published in The Lancet Infectious Diseases Highlight Best-in-Class Potential of Vaxcyte’s 24-Valent Pneumococcal Conjugate Vaccine (PCV) Candidate
— In the Study, VAX-24 Demonstrated a Safety and Tolerability Profile Similar to Prevnar 20®(PCV20) at all Doses Studied — — All 24 Serotypes of VAX-24 at Conventional 2.2 mcg PCV Dose Met or Exceeded Regulatory Immunogenicity Standards — — Results Confirm Potential of Carrier-Sparing, Cell-Free Platform Technology Underlying VAX-24 — — Topline…
Key Genes for Pyroptosis-induced Salivary Gland Inflammation
Kaiyuan Zhang,1,* Ziyue Luo,1,* Xinchao Zhu,1 Xinyi Yao,1 Dingqi Lu,2 Liying Chen,1 Tao Hong,1 Yating Ren,1 Xinchang Wang3 1Second Clinical Medical College, Zhejiang Chinese Medical University, Hangzhou, Zhejiang Province, 310053, People’s Republic of China; 2First Clinical Medical College, Zhejiang Chinese Medical University, Hangzhou, Zhejiang Province, 310053, People’s Republic of China;…
96tests | Mouse Double stranded DNA (dsDNA) Antibody IgG
Mouse Double stranded DNA (dsDNA) IgG ELISA Kit is an ELISA Kit against Mouse Double stranded DNA (dsDNA) IgG. Target Double stranded DNA (dsDNA) IgG Reactivity Mouse Tested Applications ELISA Recommended dilutions Optimal dilutions/concentrations should be determined by the end user. Storage Shipped at 4 °C. Upon receipt, store the…
tRNA therapeutics for genetic diseases
Huang, X. et al. The landscape of mRNA nanomedicine. Nat. Med. 28, 2273–2287 (2022). Article CAS Google Scholar Rohner, E., Yang, R., Foo, K. S., Goedel, A. & Chien, K. R. Unlocking the promise of mRNA therapeutics. Nat. Biotechnol. 40, 1586–1600 (2022). Article CAS Google Scholar Brown, A., Shao, S.,…
Anti-Unconventional myosin-X MYO10 Antibody Clinisciences
Product Name Anti-Unconventional myosin-X MYO10 Antibody View all myosin X Antibodies SKU/Catalog Number A03647 Size 100ul Form Liquid Description Boster Bio Anti-Unconventional myosin-X MYO10 Antibody catalog # A03647. Tested in IHC, WB applications. This antibody reacts with Human, Mouse. Storage & Handling Store at -20°C for one year. For short…
East Asian-specific and cross-ancestry genome-wide meta-analyses provide mechanistic insights into peptic ulcer disease
We conducted a three-stage genome-wide analysis of PUD and its subtypes. An overview of the workflow is provided in Fig. 1 and Supplementary Fig. 1. PUD cases in the east Asian populations were obtained by combining individuals with any of the two major PUD subtypes (DU and GU), which were…
Interrogating ligand-receptor interactions using highly sensitive cellular biosensors
Dimitrov, D. S. Virus entry: molecular mechanisms and biomedical applications. Nat. Rev. Microbiol. 2004 22 2, 109–122 (2004). Google Scholar Chen, W., Zarnitsyna, V. I., Sarangapani, K. K., Huang, J. & Zhu, C. Measuring Receptor-Ligand Binding Kinetics on Cell Surfaces: From Adhesion Frequency to Thermal Fluctuation Methods. Cell. Mol. Bioeng….
Coherus and Junshi Biosciences Announce Publication of
– Final overall survival analysis of the JUPITER-02 trial shows first-line treatment with LOQTORZI plus chemotherapy significantly prolongs survival in patients with recurrent or metastatic NPC irrespective of PDL-1 status– – Treatment resulted in a 37% reduction in the risk of death versus chemotherapy alone – -– LOQTORZI is the…
Immune-privileged tissues formed from immunologically cloaked mouse embryonic stem cells survive long term in allogeneic hosts
Mice C57BL/6N (strain 005304), C3H/HeJ (strain 000659), FVB/NJ (strain 001800), BALB/cJ (strain 000651) and NSG mice (stock 005557) were purchased from the Jackson Laboratory. CD-1 (stock 022) mice were purchased from Charles River. Mice (6–20-week-old) of each strain/background were used for teratoma assays. Mice were housed in a pathogen-free facility…
High-throughput screening of genetic and cellular drivers of syncytium formation induced by the spike protein of SARS-CoV-2
Plasmid construction All the constructs used in this study were generated with standard cloning strategies, including PCR, overlapping PCR, oligo annealing, digestion and ligation. Primers were purchased from Genewiz. The plasmid sequence was verified by Sanger sequencing. The pCAG-spike(D614G)-GFP11-mCherry plasmid was modified from Addgene plasmid 158761. Briefly, GFP11 and mCherry…
SMAD4 Rabbit Polyclonal Antibody Clinisciences
Product Data Applications WB Recommended Dilution WB: 1:500-1:3000 Reactivities Human, Mouse, Rat Host Rabbit Isotype IgG Clonality Polyclonal Immunogen The immunogen for anti-Smad4 Antibody: A synthesized peptide derived from human Smad4 Formulation Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store…
Fermentation | Free Full-Text | Whole-Genome Sequencing of Lactiplantibacillus plantarum YY-112 and Investigation of Its Immune-Modulating Abilities In Vivo
Author Contributions Conceptualization, Y.Y. and Y.G.; Data curation, M.L. and W.Z.; Formal analysis, M.L., W.Z., W.T. and J.L.; Funding acquisition, Y.Y. and Y.G.; Investigation, J.X., Y.Y. and Y.G.; Methodology, M.L., J.L. and Y.Y.; Project administration, Y.Y.; Resources, J.X., Y.Y. and Y.G.; Software, M.L., W.Z. and W.T.; Supervision, J.X., Y.Y. and…
Analysis of nucleoporin 107 overexpression
Introduction Lung cancer is one of the most common types of cancer worldwide and the leading cause of cancer death.1 The main category of lung cancer is non-small cell lung cancer, accounting for about 85%, and lung adenocarcinoma, as a kind of non-small cell lung cancer, is the most frequently…
Elevated stress response marks deeply quiescent reserve cells of gastric chief cells
Generation of inducible H2b-GFP knock-in mice Generation of inducible H2b-GFP knock-in mice was performed by using CRISPR/Cas943. In brief, a mixture containing a sgRosa26-1 crRNA43 (8.7 ng/μl, Fasmac, Japan), a tracrRNA (14.3 ng/μl, Fasmac, Japan), a single strand oligo donor nucleotide (ssODN) composed of 5′ arm, adenovirus splicing acceptor, SV40 pA, TRE3G…
LncRNA INHEG promotes glioma stem cell maintenance and tumorigenicity through regulating rRNA 2’-O-methylation
Ethics statement All mice procedures in this study were performed under an animal protocol approved by the Institutional Animal Care and Use Committee guidelines of Westlake University. The procedures and protocols for glioma patients were approved by the institutional review board of Beijing Tiantan Hospital. Informed consent was obtained from…
Iron derived from NCOA4-mediated ferritinophagy causes cellular senescence via the cGAS-STING pathway
Materials and reagents Tert-butyl hydroperoxide (TBH) were purchased from Sigma-Aldrich (St. Louis, USA). Ferric ammonium citrate (FAC) and D-galactose (D-gal) was obtained from Selleck (Shanghai, China) and Aladdin (Shanghai, China), respectively. Deferoxamine (DFO), Mito-TEMPO (Mito-T), 3-Methyladenine (3-MA), Chloroquine (CQ), Bafilomycin A1 (Baf-A1), and H-151 were purchased from MedChemExpress (NJ, USA)….
GDF11 slows excitatory neuronal senescence and brain ageing by repressing p21
Experimental model and subject details Mice Male ICR mice (Laboratory Animal Center of Zhejiang Academy of Medical Sciences) at age of 3 months (M), 9 M and 36 M, male C57BL/B6 wild‐type (WT) mice (Shanghai Slac Laboratory) at age of 3 M and 10 M, male GDF11-flox mice (GDF11f/f, mice carrying the “floxed” GDF11…
COL10A1 promotes tumorigenesis by modulating CD276 in pancreatic adenocarcinoma | BMC Gastroenterology
Bioinformatics analysis The GEO database (www.ncbi.nlm.nih.gov/geo/) provided detailed gene expression information for the GSE62165 microarray. Differentially expressed genes were identified using the online tool Morpheus (software.broadinstitute.org/morpheus/) (fold change = normal pancreatic tissue gene expression/PDAC tissue gene expression, P value < 0.05 and |log2(fold change)|>1). The downstream analysis was based on the genes with the…
RhoA suppresses pseudorabies virus replication in vitro | Virology Journal
Materials The Cell Counting Kit-8 (CCK-8) was ordered from Yeasen BioTechnologies co, Ltd. (Shanghai, China). Anti-GAPDH was purchased from Proteintech Group, Inc. (Chicago, USA). Anti RhoA was purchased from Novus Biologicals (Colorado, USA). Antiserum against PRV glycoprotein gB was generated by immunization of mice with purified recombinant gB. Goat anti-Mouse…
Clinical implications of discordance between anti-dsDNA antibodies by multiplex flow immunoassay and Crithidia luciliae assay in a multiethnic racial cohort of patients with SLE
WHAT IS ALREADY KNOWN ON THIS TOPIC A gold standard assay for anti-dsDNA antibodies (anti-dsDNA) antibody detection in SLE diagnosis and disease activity monitoring does not exist. Of the two most used assays, enzyme immunoassays (EIAs) are considered to be more sensitive and less specific compared with Crithidia luciliae immunofluorescence…
10 Asia-Pacific companies leading innovation in the region
Asia-Pacific is now establishing itself as a global innovation hub, with China, Japan, and Korea leading the space in overall innovative pipeline assets in the region. The life sciences industry is thriving, and there has been a shift in the region from predominantly producing generics to developing innovative technologies, with…
PPP1R12A is a recycling endosomal phosphatase that facilitates YAP activation
Antibodies Antibodies used in the present study were as follows: rabbit anti-phospho-YAP (S127) (#13008, dilution 1:500), rabbit anti-phospho-LATS1 (S909) (#9157, dilution 1:500), rabbit anti-YAP (#14074, dilution 1:100 for immunofluorescence), and rabbit anti-PPP1R12A (#8574, dilution 1:1000 for western blot, 1:200 for immunofluorescence) from Cell Signaling Technology; rabbit anti-LATS1 (A300-477A, dilution 1:2000)…
Ginsenoside Rg3 enriches SCFA-producing commensal bacteria to confer protection against enteric viral infection via the cGAS-STING-type I IFN axis
Rg3 elicits protection against local and systemic enteric virus infection by regulating the intestinal microbiome To assess the antiviral effects of Rg3 in vivo, groups of C57BL/6J mice (referred to as WT B6 hereafter) were orally administered Rg3 for 3 consecutive days, inoculated with MNV-1 by the peroral route, and…
Identification of DNA damage response-related genes as biomarkers for castration-resistant prostate cancer
mRNA expressions of DDR-related genes are upregulated in CRPC compared to those in Pca To identify a cluster of upregulated genes in CRPC, we previously conducted directional RNA-seq analysis using clinical samples obtained from localized Pca and CRPC patients21. We used RNA samples obtained from prostate cancer patients by radical…
Biological and genetic characterization of a newly established human external auditory canal carcinoma cell line, SCEACono2
Ethic statement The Clinical Research Ethics Review Committee of Kyushu University Hospital approved the study (permit no. 29-43, 30-268, and 700-00). Written informed consent for the current research project was obtained before the tumor tissue, and a blood sample were harvested. This study was also conducted according to the principles…
Characterization of intrinsic and effective fitness changes caused by temporarily fixed mutations in the SARS-CoV-2 spike E484 epitope and identification of an epistatic precondition for the evolution of E484A in variant Omicron | Virology Journal
Cele S, Gazy I, Jackson L, Hwa SH, Tegally H, Lustig G, et al. Escape of SARS-CoV-2 501Y.V2 from neutralization by convalescent plasma. Nature. 2021;593(7857):142–6. Article CAS PubMed PubMed Central Google Scholar Planas D, Bruel T, Grzelak L, Guivel-Benhassine F, Staropoli I, Porrot F, et al. Sensitivity of infectious SARS-CoV-2…
FAT10 is phosphorylated by IKK{beta} to inhibit the antiviral type-I interferon response
Introduction The innate immune system represents the host´s first-line defense against viral infections (Koyama et al, 2008). In this context, IFN-I are produced by all nucleated cells and represent the principal cytokines that counteract viral replication (Ivashkiv & Donlin, 2014). In fact, several receptors of the infected cell can recognize…
Nascent ribosomal RNA act as surfactant that suppresses growth of fibrillar centers in nucleolus
Transcription and RNA processing The occupancy \({n}_{{{{{{\rm{ps}}}}}}}\) of the TSS of the active rDNA by Pol I follows the kinetic equation $$\frac{d}{{dt}}{n}_{{{{{{\rm{ps}}}}}}}={k}_{{{{{{\rm{on}}}}}}}\rho \left(1-{n}_{{{{{{\rm{ps}}}}}}}\right)-{k}_{{{{{{\rm{off}}}}}}}{n}_{{{{{{\rm{ps}}}}}}}-{k}_{{{{{{\rm{e}}}}}}}{n}_{{{{{{\rm{ps}}}}}}}.$$ (5) Equation (5) suggests that the occupancy \({n}_{{{{{{\rm{ps}}}}}}}\) changes due to the binding of Pol I from the FC (the first term), the unbinding of Pol I…
An FcRn-targeted mucosal vaccine against SARS-CoV-2 infection and transmission
Mice and Golden Syrian hamsters All research experiments in this study comply with all relevant ethical regulations. The Institutional Animal Care and Use Committee approved the animal protocol at the University of Maryland (#R-APR-20-18 and #R-MAR-21-19). The animals were acclimatized at the animal facility for 4–6 days before initiating experiments….
The DNA-binding induced (de)AMPylation activity of a Coxiella burnetii Fic enzyme targets Histone H3
Statistics and reproducibility Anti-AMP IP for LC-MS/MS analysis was performed in three independent biological replicates (n = 3). TSA assay data represents technical triplicates. Time-resolved (de)AMPylation analyzed by LC-MS was performed as biological triplicates. CD measurements were performed in technical triplicates. Anisotropy data is shown as technical triplicates. Anisotropy measurements were repeated…
Human dsDNA Autoantibody (IgG) ELISA kit
This product is an ELISA kit for the determination of dsDNA Autoantibody in human Plasma or Serum. It is highly sensitive and available for the detection of dsDNA Autoantibody as low as 1.0 IU/mL . Datasheet Specifications Sensitivity 1.0 IU/mL (0 to 200 IU/mL) …
Both chimpanzee adenovirus-vectored and DNA vaccines induced long-term immunity against Nipah virus infection
Ethics statement The animal experiments were approved by the Animal Ethics Committee of the Wuhan Institute of Virology, Chinese Academy of Sciences (approval number: WIVA21202104). All animal experiments involving NiV were executed in the animal biosafety level 4 (ABSL-4) facility at the National Biosafety Laboratory (Wuhan), Chinese Academy of Sciences….
Artificial surface labelling of Escherichia coli with StrepTagII antigen to study how monoclonal antibodies drive complement-mediated killing
Delcour, A. H. Outer membrane permeability and antibiotic resistance. Biochim. Biophys. Acta 1794, 808 (2009). Article CAS PubMed Google Scholar Silhavy, T. J., Kahne, D. & Walker, S. The bacterial cell envelope. Cold Spring Harb. Perspect. Biol. 2, a000414 (2010). Article PubMed PubMed Central Google Scholar Lu, L. L., Suscovich,…
CRISPR/Cas9 bioluminescence-based assay for monitoring CFTR trafficking to the plasma membrane
Introduction Cystic fibrosis (CF) is a lethal, autosomal recessive disorder caused by mutations in the CFTR gene that results in aberrant transport of chloride, bicarbonate, and sodium ions (Kerem et al, 1989; Riordan et al, 1989; Rommens et al, 1989; Tabcharani et al, 1991; Poulsen et al, 1994; Stutts et…
Understanding the ADAPT-SC Results of Subcutaneous Efgartigimod: Tuan Vu, MD
WATCH TIME: 3 minutes “There was no new signal in terms of safety events. I think it’s [subcutaneous efgartigimod] a good option for patients who want to have the flexibility of having a subcutaneous injection at home or elsewhere.” Over the years, the treatment options for patients with generalized myasthenia…
Catalytically inactive long prokaryotic Argonaute systems employ distinct effectors to confer immunity via abortive infection
Bacterial strains and phages Escherichia coli DH5a was routinely grown in Lysogeny broth (LB) medium and used for plasmid cloning, while E. coli BL21 (DE3) was used for protein production and the in vivo assays. E. coli phages T5, T7 and Lambda-vir are gifts from Shi Chen lab (Wuhan University,…
Synergistic effects of Azithromycin and DMXAA
Kanoktip Petcharat,1 Narongsuk Munkong,2 Rungthip Thongboontho,1 Widsanusan Chartarrayawadee,3 Arthid Thim-Uam1 1Division of Biochemistry, School of Medical Sciences, University of Phayao, Phayao, 56000, Thailand; 2Department of Pathology, School of Medicine, University of Phayao, Phayao, 56000, Thailand; 3Division of Chemistry, School of Science, University of Phayao, Phayao, 56000, Thailand Correspondence: Arthid Thim-Uam,…
Longitudinal study of patients with discrepant results in CLIFT and a solid-phase dsDNA antibody assay: does a gold standard dsDNA assay exist?
What is already known on this topic The Crithidia luciliae indirect immunofluorescence test (CLIFT) has long been regarded as the gold standard in the diagnosis of SLE, but its limited sensitivity has been well documented. Solid phase assays are more sensitive for measuring double-stranded DNA (dsDNA) antibodies, but they have…
mRNA vaccine encoding Gn provides protection against severe fever with thrombocytopenia syndrome virus in mice
mRNA preparation The DNA template for the mRNA vaccine comprised a DNA fragment encoding the SFTSV Gn protein. The DNA templates were cloned into a plasmid vector with backbone sequence elements (T7 promoter, 5′- and 3′-UTR, 100 nucleotide poly(A) tail) interrupted by a linker (A50LA50, 20 nucleotides) to improve RNA…
Reduction of retinal ganglion cell death in mouse models of familial dysautonomia using AAV-mediated gene therapy and splicing modulators
Animals All mice were housed in the AALAC-accredited Animal Resource Center at Montana State University. All animal use protocols were approved by the Montana State University Institutional Animal Care and Use Committee (IACUC) (protocol No. 2020-15-IA; Bozeman, MT). The study fulfilled the ARRIVE guidelines, and all experiments complied with relevant…
CRISPR/Cas13a-Assisted Accurate and Portable Hepatitis D Virus RNA Detection
Abstract & ims: Hepatitis delta virus (HDV) infection accelerates the progression of chronic hepatitis B virus (HBV) infection, posing a large economic and health burden to patients. At present, there remains a lack of accurate and portable detection methods for HDV RNA. Here, we aim to establish a convenient, rapid,…
HanAll Biopharma reports 11% YoY Q3 revenue increase, driven by key pharmaceutical products By Investing.com
© Reuters. South Korean company, HanAll Biopharma reported an 11% year-on-year increase in Q3 2023 revenue, reaching KRW 33 billion. The company attributed this growth to robust sales from pharmaceutical products such as ‘Normix’, ‘Eligard’, and ‘BioTop’. The net profit for the quarter was KRW 300 million with an operation…
Identification of CCZ1 as an essential lysosomal trafficking regulator in Marburg and Ebola virus infections
Cells and viruses Haploid mSCs AN3–12 are a feeder independent clonal derivative of HMSc2 isolated from mice oocyte and maintained at IMBA52. The AN3–12 library and knocked out cells used for the haploid screening was obtained from IMBA (Austria)14,52. AN3–12 cells were validated by STR analysis. Haploid mES cells were…
Comparison of two lab-scale protocols for enhanced mRNA-based CAR-T cell generation and functionality
Experimental design Primary T cell isolation, expansion, and cell culture Primary T cells were isolated from human peripheral blood mononuclear cells (PBMCs) of healthy donors collected by the Institute for Transfusion Medicine of the University Clinic of Leipzig, Germany, approved by the Ethics Committee of the Faculty of Medicine of…
Antiviral type III CRISPR signalling via conjugation of ATP and SAM
Cloning Supplementary Table 1 shows the synthetic gene, DNA and RNA oligonucleotide sequences used in this study. The synthetic genes encoding B.fragilis Cas6, CorA, NrN and C. botulinum SAM lyase purchased as g-blocks (IDT) were codon-optimized for expression in E. coli C43 (DE3) via the vector pEhisV5TEV, which encodes eight…
Crohn’s Disease treatment after failure of anti-TNF therapy
Introduction Crohn’s Disease (CD) is a typical group of inflammatory bowel disease, a chronic intestinal disease with an unclear cause that fluctuates between clinical remission and relapse. The disease may affect the entirety of the gastrointestinal tract, frequently manifesting as segmental, asymmetric, and transmural lesions. 21–47% of patients present with…
Plastid-localized xanthorhodopsin increases diatom biomass and ecosystem productivity in iron-limited surface oceans
Protein sequence and prediction analysis The amino acid sequence of FcR was deduced from the F. cylindrus genome sequence33. Protein alignments with characterized microbial rhodopsins were performed using the MUSCLE algorithm implemented in Geneious (v.5.6)69. Predictions of subcellular location were performed with SignalP v.4.0 and TargetP (v.1.1)70. Putative transmembrane domains…
An Intrabody against B-Cell Receptor-Associated Protein 31 (BAP31) Suppresses the Glycosylation of the Epithelial Cell-Adhesion Molecule (EpCAM) via Affecting the Formation of the Sec61-Translocon-Associated Protein (TRAP) Complex
. 2023 Sep 30;24(19):14787. doi: 10.3390/ijms241914787. Affiliations Expand Affiliation 1 College of Life Science and Health, Northeastern University, 195 Chuangxin Road, Hunnan District, Shenyang 110819, China. Item in Clipboard Tianyi Wang et al. Int J Mol Sci. 2023. Show details Display options Display options Format AbstractPubMedPMID . 2023 Sep 30;24(19):14787. doi:…
The salvage role of allogeneic hematopoietic stem-cell transplantation in relapsed/refractory diffuse large B cell lymphoma
Baseline characteristics A total of 52 adult patients with R/R DLBCL were identified and enrolled. The median age at diagnosis was 45 years (range, 17–63), with marginal male predominance (n = 30, 57.7%). 36 patients (69.2%) were identified as having an advanced-stage disease (Ann Arbor stage III–IV), whereas 15 (28.8%) suffered from B…
Characterizing the regulatory Fas (CD95) epitope critical for agonist antibody targeting and CAR-T bystander function in ovarian cancer
Mice strains Six- to eight-week-old (age), 20–25-g (weight), both male and female (sex) mice were used for tumor xenografts generation and in vivo efficacy studies as described in the text (see Table 3). Athymic Nude (Envigo) Foxn1nu/Foxn1+ or NOD.Cg Prkdcscid Il2rgtm1Wjl/SzJ also called NSG mice were used. All animal procedures were…
EOGT enables residual Notch signaling in mouse intestinal cells lacking POFUT1
Single cell RNAseq bioinformatics Bioinformatic trajectory analysis of scRNAseq data obtained from Epcam+CD45− C57Bl6/J adult intestinal crypt cells and deposited as GSE188339 was performed as described35. Primers and antibodies Primer sequences are given in Supplementary Table 1 and antibodies are given in Supplementary Table 2. Generation of Chinese hamster ovary…
LINC01343 targets miR-526b-5p to facilitate the development of hepatocellular carcinoma by upregulating ROBO1
Tissue samples All the enrolled patients provided written informed consent. Patients who had undergone chemotherapy or radiotherapy before surgery were excluded from the study. Surgical procedures were performed to obtain 40 pairs of HCC tumor and adjacent non-tumor tissue specimens from patients admitted to the First Affiliated Hospital of Chengdu…
Apoptotic stress causes mtDNA release during senescence and drives the SASP
Cell culture and treatments Human embryonic lung MRC5 fibroblasts (ATCC) and IMR90 fibroblasts (ATCC) were grown in Dulbecco’s modified Eagle’s medium (Sigma-Aldrich, D5796) supplemented with 10% heat-inactivated fetal bovine serum (FBS), 100 U ml−1 penicillin, 100 μg ml−1 streptomycin and 2 mM l-glutamine and maintained at 37 °C under 5% CO2. MRC5 fibroblasts were cultured in…
Update on ConfIdeS Phase 3 trial of imlifidase in highly sensitized kidney transplant patients
Biologic License Application submission expected for 2025 LUND, Sweden, Oct. 11, 2023 /PRNewswire/ — Hansa Biopharma, “Hansa” (Nasdaq Stockholm: HNSA), a pioneer in enzyme technology for rare immunological conditions, today announced randomization for the US ConfIdeS trial is expected to conclude in mid-2024. The ConfIdeS trial is an open-label, controlled, randomized…
Immunoglobulin superfamily member 3 is required for the vagal neural crest cell migration and enteric neuronal network organization
Immunohistochemistry The tissue sections were processed using the TSA kit (Perkin Elmer) according to the manufacturer’s instructions. The deparaffinization of fixed tissues were performed by immersing the slides in tissue clear and rehydrated with graded ethanol (100–70%) and water. The heat-induced antigen retrieval was performed using citrate buffer (1.8 mM…
[KD Validated] Smad4 Rabbit pAb-Polyclonal Antibodies
Western blot – [KD Validated] Smad4 Rabbit pAb (A21487) Western blot analysis of HCT116, using Smad4 Rabbit pAb antibody (A21487) at 1:600 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s. Western…
Rab41-mediated ESCRT machinery repairs membrane rupture by a bacterial toxin in xenophagy
Rab8A and Rab41 are required for xenophagy of GAS For comprehensive screening of Rab GTPases involved in xenophagy against GAS infection, we first knocked down the expression of Rab GTPases in HeLa cells. We examined bacterial survival in cells at 6 h post-infection (hpi) compared with that at 2 hpi because…
Molecular characterization and functional implications on mouse peripheral blood mononuclear cells of annexin proteins from Echinococcus granulosus sensu lato | Parasites & Vectors
Parasites and animals PSCs were collected from hydatid cysts isolated from the liver of sheep infected with E. granulosus s.l. from a slaughterhouse in Sichuan province, China. The PSCs and cyst walls were separated and treated as described in previous reports [22]. The viability and molecular genotyping of PSCs were…
The potential use of bacteria and bacterial derivatives as drug delivery systems for viral infection | Virology Journal
Novel approaches to treating viral illnesses must be developed. Drug delivery methods based on nanomaterials are attractive options in the search for therapeutic advantages because of their distinctive properties. Researchers should also examine how the most prevalent viruses, such as the flu, HIV, SARS-CoV-2, monkeypox, and HPVs, are being treated…
A Phase 3, randomized, non-inferiority study of a heterologous booster dose of SARS CoV-2 recombinant spike protein vaccine in adults
Disposition of participants ChAdOx1 nCoV-19 prime cohort A total of 190 participants were enrolled and 187 were randomized. Of these, 186 received the study vaccine (92 SII-NVX-CoV2373 and 94 ChAdOx1 nCoV-19). Only a single participant withdrew the consent before day 29. The safety population comprised 186 participants, both full analysis…
In planta expression of human polyQ-expanded huntingtin fragment reveals mechanisms to prevent disease-related protein aggregation
Plant material and constructs A. thaliana lines of Columbia-0 (Col-0) ecotype were employed, including WT, toc159 (refs. 58,59) and cct8-2 (ref. 60). Seeds underwent surface sterilization and germination on solid 0.5× Murashige and Skoog (M&S) medium with vitamins, lacking sucrose. Plants were incubated in a growth chamber at 22 °C under…
Antibodies to dsDNA are present in 70 of patients with lupus and are highly
Antibodies to dsDNA are present in 70% of patients with lupus and are highly specific for the disease. Anti-dsDNA and complement proteins have been found in immune complexes that are deposited in organs such as the kidneys and skin and are thought to play a major role in the pathogenesis…
UNRAVELING CHO METABOLIC PROCESSES USING STABLE ISOTOPE LABELING TO ENHANCE BIOPROCESS PERFORMANCE
Abstract Chinese Hamster Ovary (CHO) cells are the preferred host systems for recombinant protein therapeutics production including monoclonal antibodies and fusion proteins. CHO cells have the ability to grow in high densities in suspension and produce glycosylation patterns that are compatible with humans. Improving CHO cell productivity and product quality…
TRIM25 targets p300 for degradation
Introduction Protein levels are regulated at several nodes. One mode of protein level regulation acts through enhancing or reducing gene transcription. Gene transcription can be stimulated by binding transcription factors to promoters or enhancers of target genes and by posttranslational modifications of transcription factors and histones. Such modifications can be…
Assembloid CRISPR screens reveal impact of disease genes in human neurodevelopment
Culture of hiPS cells The hiPS cell lines used in this study were validated as previously described51. The SEC61B-mEGFP hiPS cell line (AICS-0059 cl.36) was developed at the Allen Institute for Cell Science (www.allencell.org/cell-catalog.html) and is distributed through Coriell43. The CAG::Cas9 cell line was genetically engineered in the laboratory (the…
Broad sialic acid usage amongst species D human adenovirus
Generation and purification of recombinant fiber knob proteins pQE expression plasmids (Qiagen, Manchester, UK) containing DNA encoding species D fiber knob proteins were produced by TWIST Biosciences (San Francisco, USA). The vectors were transformed by heat shock into competent SG13009 Escherichia coli (E.coli) bacteria containing a pREP4–4 plasmid. Heat shock…
A computationally designed antigen eliciting broad humoral responses against SARS-CoV-2 and related sarbecoviruses
Phylogenetic analysis Protein sequences of spike proteins were downloaded from the NCBI virus database for all the known sarbecoviruses (June 2020). A multiple sequence alignment was generated using MUSCLE36. The resulting multiple sequence alignment was pruned to the RBD region, filtered at 95% sequence identity and used as input for…
Schistosoma japonicum EKLF/KLF1 is a potential immune target to tackle schistosomiasis | Parasites & Vectors
Animals and parasites Snails infected with S. japonicum (Oncomelania hupensis) were provided by the Jiangxi Provincial Institute of Parasitic Diseases, Jiangxi, China. Freshly released cercariae stimulated by light were immediately harvested. Six-week-old pathogen-free male BALB/c mice and New Zealand white rabbits (both from Vital River Laboratory Animal Technology Co., Beijing,…
Sci-Hub | Transient ammonia stress on Chinese hamster ovary (CHO) cells yield alterations to alanine metabolism and IgG glycosylation profiles. Biotechnology Journal, 16(7), 2100098
Sci-Hub | Transient ammonia stress on Chinese hamster ovary (CHO) cells yield alterations to alanine metabolism and IgG glycosylation profiles. Biotechnology Journal, 16(7), 2100098 | 10.1002/biot.202100098 ◂ ↓ save Synoground, B. F., McGraw, C. E., Elliott, K. S., Leuze, C., Roth, J. R., Harcum, S. W., & Sandoval, N. R….
Products | Abnova
Product Description Rabbit monoclonal antibody raised against a human SMAD4 peptide using ARM Technology. Immunogen A synthetic peptide of human SMAD4 is used for rabbit immunization.Customer or Abnova will decide on the preferred peptide sequence. Library Construction Non-fusion antibody library from rabbit spleen (ARM Technology). Expression …
Transcriptomics Meta-Analysis Reveals Phagosome and Innate Immune System Dysfunction as Potential Mechanisms in the Cortex of Alzheimer’s Disease Mouse Strains
Aken BL, Ayling S, Barrell D, Clarke L, Curwen V, Fairley S et al (2016) The Ensembl gene annotation system. Database (Oxford) baw093 Bagaria J, Nho K, An SSA (2021) Importance of GWAS in finding un-targeted genetic association of sporadic Alzheimer’s disease. Mol Cell Toxicol 17(3):233–244 Article CAS Google Scholar …
Cell-free chromatin immunoprecipitation to detect molecular pathways in heart transplantation
Abstract Existing monitoring approaches in heart transplantation lack the sensitivity to provide deep molecular assessments to guide management, or require endomyocardial biopsy, an invasive and blind procedure that lacks the precision to reliably obtain biopsy samples from diseased sites. This study examined plasma cell-free DNA chromatin immunoprecipitation sequencing (cfChIP-seq) as…
mRNA vaccine quality analysis using RNA sequencing
Design and synthesis of reference plasmid A reference construct was first designed, with the intention of optimising the production of RNA therapeutics for pre-clinical research. The coding sequence of eGFP30 was selected as a reporter in the coding region, as its protein product can be assayed simply through Flow cytometry…
Genome-wide probing of eukaryotic nascent RNA structure elucidates cotranscriptional folding and its antimutagenic effect
Yeast strain and growth conditions S. cerevisiae strain BY4741 was grown in YPD media at 30 °C. Saturated cultures were diluted into 300 ml YPD medium with an optical density at 660 nm (OD660) of approximately 0.1 and then grown at 30°C with shaking at 250 rpm until mid-log phase with an OD660 of…
MAST4 promotes primary ciliary resorption through phosphorylation of Tctex-1
Introduction The primary cilium (9 + 0 architecture) is a microtubule-based immotile sensory organelle in vertebrates (Tucker et al, 1979). Enormous progress has been made in the past several decades concerning our understanding of the structure and functions of the primary cilium (Sung & Leroux, 2013). The subdomain between the…
Total Flavonoids of Rhizoma Drynariae Treat Osteoarthritis
Introduction Osteoarthritis (OA) is a common degenerative joint disease characterized by chronic pain and ambulation limitation, affecting about 250 million people worldwide.1 With increased aging population, the OA incidence rapidly increases and OA has become a major cause of disability.2,3 The morbidity of OA is closely related to articular cartilage,…
How DNA testing is reuniting families after decades apart
Advances in DNA testing and genealogy kits are reuniting families with members who have been lost for decades. Here’s some stories of exactly how this happening In 2018, Jeff Highsmith of Texas started a Facebook page on behalf of his family. The page had one objective: to find Melissa Suzanne…
Drug delivery systems for CRISPR-based genome editors
Li, Y., Glass, Z., Huang, M., Chen, Z. Y. & Xu, Q. Ex vivo cell-based CRISPR/Cas9 genome editing for therapeutic applications. Biomaterials 234, 119711 (2020). Article CAS PubMed PubMed Central Google Scholar Dong, W. & Kantor, B. Lentiviral vectors for delivery of gene-editing systems based on CRISPR/Cas: current state and…
hypothetical protein LOTGIDRAFT_112989, maker-scaffold299_size217019-snap-gene-1.29 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of hypothetical protein LOTGIDRAFT_112989 vs. L. salmonis genes Match: EMLSAG00000011196 (supercontig:LSalAtl2s:LSalAtl2s761:366436:368626:1 gene:EMLSAG00000011196 transcript:EMLSAT00000011196 description:”maker-LSalAtl2s761-augustus-gene-2.9″) HSP 1 Score: 208.764 bits (530), Expect = 1.424e-65Identity = 100/171 (58.48%), Postives = 126/171 (73.68%), Query Frame = 0 Query: 120 NPIVFFDITIGGDPVGRIVMELYANVVPKTVDNFRALCTGEKGQVGGSGIPLHYKNSSFHRVINRFMLQGGDFTAGDGTGGASIYGEKFADENFLLKHEKPGLLSMANAGPGTNGSQFFLTTVNCPHLDGKHVVFGRAIKGMGIVNEIEVMETT-SDKPNVEVKIADCGQI 289 NP+VFFDI +G +GRIVMEL+A+V PKT +NFR CTGE…