Tag: LD
Evaluation of Acute Adverse Events after Covid-19 Vaccination during Pregnancy
To the Editor: Pregnant women with symptomatic coronavirus disease 2019 (Covid-19) have a higher risk of adverse outcomes than do women who are not pregnant.1,2 In part because of these findings, Covid-19 vaccination has been recommended for pregnant women. However, uptake has been lower in pregnant women than among women…
ERROR No such moleculetype NA – User discussions
GROMACS version:GROMACS modification: Yes/No I got this errorwhen I run the line: gmx grompp -f em.mdp -c solv_ions.gro -p topol.top -o em.tpr -maxwarn 10in the topol.top there is 3 NA atoms 🙂 GROMACS – gmx grompp, 2020.1-Ubuntu-2020.1-1 (-: GROMACS is written by: Emile Apol Rossen Apostolov Paul Bauer Herman J.C….
Genome-wide association study of musical beat synchronization demonstrates high polygenicity
Savage, P. E., Brown, S., Sakai, E. & Currie, T. E. Statistical universals reveal the structures and functions of human music. Proc. Natl Acad. Sci. USA 112, 8987–8992 (2015). CAS PubMed PubMed Central Article Google Scholar Ravignani, A., Delgado, T. & Kirby, S. Musical evolution in the lab exhibits rhythmic…
Allelic expression imbalance of PIK3CA mutations is frequent in breast cancer and prognostically significant
Subjects Normal breast and tumor samples were obtained with the written informed consent from donors and appropriate approval from local ethical committees, with the detailed information described in the respective original publications: normal tissue9, METABRIC14, TCGA35. Differential allelic expression analysis DNA and total RNA from 64 samples of normal breast…
main-i386-default][science/cp2k] Failed for cp2k-9.1.0 in configure
You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: y…@freebsd.org Log URL: beefy17.nyi.freebsd.org/data/main-i386-default/p429f3de9bdcd_s2573e6ced9/logs/cp2k-9.1.0.log Build URL: beefy17.nyi.freebsd.org/build.html?mastername=main-i386-default&build=p429f3de9bdcd_s2573e6ced9 Log: =>> Building science/cp2k build started at Sat Jun 4…
Help with PCA plot from SNPRelate
Hello, BioStars community! I am working on a datase of 50 samples(between cases and controls) with genotyping data for ~200 SNPs. I ran SNPRelate PCA analysis without adding population data and tried to plot its results. My PCA plot seems a bit “strange” since the observations did not come together…
Remove related individuals pre or post ld-pruning before GWAS?
Remove related individuals pre or post ld-pruning before GWAS? 0 I’m doing a GWAS on a dataset that contains some related individuals. To avoid false positives, I’m removing related individuals from the dataset as well as doing LD pruning. However, I am unsure what order should the algorithm follow and…
Integrative analysis of eQTL and GWAS summary statistics reveals transcriptomic alteration in Alzheimer brains | BMC Medical Genomics
Significant gene-AD associations With the GWAS summary data from the IGAP and eQTL summary data from BRAINEAC, we performed both SMR and HEIDI tests to estimate the gene-AD associations in three human brain regions: frontal cortex, temporal cortex, and hippocampal regions. For the frontal cortex and hippocampal regions, we obtained…
Long-term artificial selection of Hanwoo (Korean) cattle left genetic signatures for the breeding traits and has altered the genomic structure
Cattle are among the largest populations of domesticated animals and used as food resources for humans; therefore, their phenotypes and genetic structure have been shaped by artificial selection for human needs and natural adaptation to environmental changes. The phenotypic selection causes genomic changes in breeding traits within breeds, resulting in…
Pangenome-based genome inference allows efficient and accurate genotyping across a wide spectrum of variant classes
Sequencing data We used publicly available sequencing data from the GIAB consortium45, 1000 Genomes Project high-coverage data46 and Human Genome Structural Variation Consortium (HGSVC)4. All datasets include only samples consented for public dissemination of the full genomes. Statistics and reproducibility For generating the assemblies, we used all 14 samples for…
MBEDTLS 2.27.0 and stack – githubhot
Since MBEDTLS 2.27.0 is merged, a call to mbedtls_x509_crt_verify() fails: E/TC:? 0 E/TC:? 0 User mode data-abort at address 0x10ff3c (write permission fault) E/TC:? 0 fsr 0x0000080f ttbr0 0x24067859 ttbr1 0x24060059 cidr 0x2 E/TC:? 0 cpu #0 cpsr 0x60000130 E/TC:? 0 r0 0x0010ff38 r4 0x0010fb38 r8 0x00110380 r12 0xfffd34b4 E/TC:?…
Enable MBEDTLS debugging Nordic provided security backend (for CoAP Secure via OpenThread on nRF5340) – Nordic Q&A – Nordic DevZone
Goal Hi guys, is there an option to enable MBEDTLS debugging as with the CONFIG_MBEDTLS_DEBUG_LEVEL=4 for the MBEDTLS_BUILTIN? I am trying to setup a DTLS client based in order to establish a CoAP Secure Session via Openthread to a Borderrouter and I am struggling in the handshake process. It would…
Phylogenomic analysis of Syngnathidae reveals novel relationships, origins of endemic diversity and variable diversification rates | BMC Biology
Stölting KN, Wilson AB. Male pregnancy in seahorses and pipefish: beyond the mammalian model. Bioessays. 2007;29:884–96. PubMed Google Scholar Whittington CM, Friesen CR. The evolution and physiology of male pregnancy in syngnathid fishes. Biol Rev Camb Philos Soc. 2020;95:1252–72. PubMed Google Scholar Rosenqvist G, Berglund A. Sexual signals and mating…
Running rstudio (but not R alone) inside of a conda environment complains about finding Rccp.so
I find that when I try to load some packages in a conda environement, when using rstudio (but not when I’m using R directly), I get an error message about a missing Rcpp.so file. I activate my conda environment (which is running R version 4.1), open RStudio (which I installed…
#1007974 – polyml: autopkgtest regression on amd64: relocation in read-only section `.text’
#1007974 – polyml: autopkgtest regression on amd64: relocation in read-only section `.text’ – Debian Bug report logs Reply or subscribe to this bug. Toggle useless messages Report forwarded to debian-bugs-dist@lists.debian.org, Debian Science Maintainers <debian-science-maintainers@lists.alioth.debian.org>:Bug#1007974; Package src:polyml. (Sat, 19 Mar 2022 20:39:04 GMT) (full text, mbox, link). Acknowledgement sent to Paul…
Pymc3 linker error – v3
Hi all,I have been using pymc3 for about a year. A few months ago I changed from an intel mac to an M1 mac. Suddenly, I can’t use pymc3 anymore. I keep getting the following error that I have no idea how to interpret: You can find the C code…
Nvt.tpr -I couldn’t manage my nvt.tpr – User discussions
GROMACS version:2022-cp2k interface I couldn’t manage my nvt.tpr I tried to fix problem but I couldn’t. gmx_cp2k grompp -f nvt.mdp -c confout.gro -r confout.gro -p topol.top -n index.ndx -o nvt.tpr nvt.mdb file :; md-nvt.mdp – used as input into grompp to generate nma-nvt.tprintegrator = md ; MD using leap-frog integratordt…
JUWELSBOOSTER module browser
HTSlib Compiler/GCCcore/11.2.0 1.14 Description =========== A C library for reading/writing high-throughput sequencing data. This package includes the utilities bgzip and tabix More information ================ – Homepage: www.htslib.org/ – Site contact: Support <sc@fz-juelich.de>, software installed by Alexandre Strube <a.strube@fz-juelich.de> EBROOTHTSLIB /p/software/juwelsbooster/stages/2022/software/HTSlib/1.14-GCCcore-11.2.0 EBVERSIONHTSLIB 1.14 EBDEVELHTSLIB /p/software/juwelsbooster/stages/2022/software/HTSlib/1.14-GCCcore-11.2.0/easybuild/Compiler-GCCcore-11.2.0-HTSlib-1.14-easybuild-devel +CMAKE_PREFIX_PATH /p/software/juwelsbooster/stages/2022/software/HTSlib/1.14-GCCcore-11.2.0 +CPATH /p/software/juwelsbooster/stages/2022/software/HTSlib/1.14-GCCcore-11.2.0/include +LD_LIBRARY_PATH /p/software/juwelsbooster/stages/2022/software/HTSlib/1.14-GCCcore-11.2.0/lib…
peroxisomal multifunctional enzyme type 2-like, maker-scaffold366_size194251-snap-gene-0.19 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of peroxisomal multifunctional enzyme type 2-like vs. L. salmonis genes Match: EMLSAG00000010112 (supercontig:LSalAtl2s:LSalAtl2s668:190059:194758:1 gene:EMLSAG00000010112 transcript:EMLSAT00000010112 description:”augustus_masked-LSalAtl2s668-processed-gene-1.1″) HSP 1 Score: 102.064 bits (253), Expect = 2.195e-25Identity = 65/191 (34.03%), Postives = 101/191 (52.88%), Query Frame = 0 Query: 134 GKVALVTGAGGGLGKAYALLLASRGASVVVNDLGGSRTGEGQSSKAADEVVNEIRQKGGKAV—–GNYDSVEDGEAVIKTALDNFGRIDIVINNAGILRDRSIGRTSDSDWDLVQKVHLRGAFQVIRAAWPHMKKQKYGRIINTSSVAGIFGNFGQSNYSSAKAGLIGLTSTLAIEGERSGIQANVIVP 319 GKVAL+TGA G+G++ A+L A…
snp.plotter_ input files
snp.plotter_ input files 0 Dear friends I’m running an LD analysis using the package of snp.plotter in R The problem that I’m facing right now is the files that I need to use for running the analysis My first question is why there is no template for the config.file??? what…
Frontiers | Association of Maternal Dietary Habits and MTHFD1 Gene Polymorphisms With Ventricular Septal Defects in Offspring: A Case-Control Study
Introduction Congenital heart disease (CHD) refers to a group of anatomic heart and great vessel malformations that arise during the embryologic development of the fetus. CHD is one of the most prevalent birth defects, affecting around 2.50 out of every 1,000 births in China (1), and it imposes a substantial…
Adding ions ‘gmx grompp’ creates error “Atomtype ca not found” for ligand generated with GAFF – User discussions
GROMACS version: 2018GROMACS modification: No Hello, I am trying to run 200ns on protein-ligand complex and then calculate MMPBSA for the last 100 ns generated frames. I had some problems with ligand parameterization with cgenff, hence I used gaff…I have: GAFF to generate parameters for the ligand acpype to convert…
Gst-nvivafilter – Jetson AGX Xavier
Platforms: Jetson AGX Xavier Jetpack 4.5 Cuda 10.2 IMX274 camera Hi fellow developers, I am having difficulties at making custom CUDA implementation. I have succesfully run the below pipeline. gst-launch-1.0 nvarguscamerasrc ! ‘video/x-raw(memory:NVMM), width=(int)3840, height=(int)2160, format=(string)NV12, framerate=(fraction)60/1’ ! nvivafilter cuda-process=true customer-lib-name=”libnvsample_cudaprocess.so” ! ‘video/x-raw(memory:NVMM), format=(string)NV12’ ! nvvidconv ! nvegltransform ! nveglglessink…
Time-course RNASeq of Camponotus floridanus forager and nurse ant brains indicate links between plasticity in the biological clock and behavioral division of labor | BMC Genomics
1. Sharma VK. Adaptive significance of circadian clocks. Chronobiol Int. 2003;20(6):901–19. PubMed Google Scholar 2. Paranjpe DA, Sharma VK. Evolution of temporal order in living organisms. J Circadian Rhythms. 2005;3(1):7. PubMed PubMed Central Google Scholar 3. Yerushalmi S, Green RM. Evidence for the adaptive significance of circadian rhythms. Ecol Lett….
Long non-coding RNA MSTRG.81401 short hairpin RNA relieves diabetic neuropathic pain and behaviors of depression by inhibiting P2X4 receptor expression in type 2 diabetic rats
1. Nicodemus JM, Enriquez C, Marquez A, Anaya CJ, Jolivalt CG (2017) Murine model and mechanisms of treatment-induced painful diabetic neuropathy. Neuroscience 354:136–145. doi.org/10.1016/j.neuroscience.2017.04.036 CAS Article PubMed Google Scholar 2. Morimoto SS, Kanellopoulos D, Manning KJ, Alexopoulos GS (2015) Diagnosis and treatment of depression and cognitive impairment in late life….
The Genetic Architecture of Sleep Health Scores in the UK
Introduction Sleep is a complex neurological and physiological state. It is defined as a natural and reversible state of reduced responsiveness to external stimuli and relative inactivity, accompanied by a loss of consciousness.1 Sleep disorders can be classified as seven major categories: insomnia disorders, sleep-related breathing disorders, central disorders of…
docx files fail to open in RStudio on Debian (at least 11) – Java rstudio
System details RStudio Edition : Dektop RStudio Version : 1.4.1717 and 2021.09.0+350 OS Version : Debian 11 R Version : 4.0.4 Steps to reproduce the problem Knit an R Markdown file to Word format. The file should be created. However, it’s not automatically opened. Click on the file in the…
main-armv7-default][science/cp2k-data] Failed for cp2k-data-7.1.0 in stage
You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: y…@freebsd.org Log URL: beefy12.nyi.freebsd.org/data/main-armv7-default/p772274a15b8b_s0630a06b2a/logs/cp2k-data-7.1.0.log Build URL: beefy12.nyi.freebsd.org/build.html?mastername=main-armv7-default&build=p772274a15b8b_s0630a06b2a Log: =>> Building science/cp2k-data build started at Sun Dec 19…
Very important pharmacogene variants in the Blang population
Introduction The use of drugs should be different among diverse ethnic groups because of differences in ethnicity, age, sex, environmental factors and genetic factors. If these differences are ignored, then drug sensitivity, metabolic rate, and adverse reactions are affected, which influences the curative effect of drugs and aggravates the illness…
How can I make sure certain SNPs are not removed during the clumping stage of PRS calculation using PRSice
How can I make sure certain SNPs are not removed during the clumping stage of PRS calculation using PRSice 1 This is a two part question. First, when implementing PRSice, is there a way to make sure certain SNPs are retained for the PRS calculation? I basically want to avoid…
[pymc-devs/pymc] pymc3 does not work properly with lower versions of Glibc
Description of your problem I am trying to install pymc3 on a centos6 server. The various environment software versions on the server are relatively low. I used miniconda3 to create an environment to install pymc3, and I can install it successfully, but it reports an error when importing pymc3. Please…
Reference panel data to be used for GCTA-COJO
Reference panel data to be used for GCTA-COJO 0 I performed a genome-wide meta-analysis based on summary statistics from the four cohorts to identify significant loci. Next, I would like to perform a conditional analysis using GCTA-COJO to search for SNPs independent of significant lead SNPs. I know that GCTA…
FTBFS on riscv64, linked with -lpthread instead of -pthread
Package: fastp Version: 0.23.2+dfsg-1 Severity: normal Tags: ftbfs upstream patch User: debian-ri…@lists.debian.org Usertags: riscv64 Dear maintainer, fastp currently fails to build from source on riscv64: | g++ ./obj/adaptertrimmer.o ./obj/basecorrector.o ./obj/duplicate.o ./obj/evaluator.o ./obj/fastareader.o ./obj/fastqreader.o ./obj/filter.o ./obj/filterresult.o ./obj/htmlreporter.o ./obj/jsonreporter.o ./obj/main.o ./obj/nucleotidetree.o ./obj/options.o ./obj/overlapanalysis.o ./obj/peprocessor.o ./obj/polyx.o ./obj/processor.o ./obj/read.o ./obj/readpool.o ./obj/seprocessor.o ./obj/sequence.o ./obj/stats.o ./obj/threadconfig.o…
alphafold2: HHblits failed – githubmemory
I’ve tried using the standard alphafold2 setup via docker (converted to a singularity container) via the setup described at github.com/kalininalab/alphafold_non_docker, and both result in the following error: […] E1210 12:01:01.009660 22603932526400 hhblits.py:141] – 11:49:18.512 INFO: Iteration 1 E1210 12:01:01.009703 22603932526400 hhblits.py:141] – 11:49:19.070 INFO: Prefiltering database E1210 12:01:01.009746 22603932526400 hhblits.py:141]…
How can I calculate LD ?
How can I calculate LD ? 0 I have sequencing data in .vcf format of expanded whole exome sequencing of 2 trios (father, mother & index) one family is affected and another is not affected, I want to find out whether any linkage block is present in any one of…
Frontiers | The cGAS-STING Pathway: A Promising Immunotherapy Target
Introduction Invaded by exogenous or endogenous pathogens, the host immune system will be activated accordingly to resist harm and maintain homeostasis, which includes innate immunity and adaptive immunity. As the first line of host immune defense, innate immunity plays a critical role in recognizing extracellular and intracellular pathogens (1, 2)….
Ethnic Diversity of DPD activity and the DPYD Gene
Plain Language Summary Fluoropyrimidine (FP; 5-FU, capecitabine) is a common chemotherapy used to treat many different cancers, including cancer of the colon and rectum, upper digestive tract, breast and head and neck. Cancer patients who receive FP chemotherapy are at risk of developing severe side effects from their treatment. A…
Issue with installing QIIME2 2021.11 on Windows 10 – Technical Support
Hi QIIME support team, I’m attempting to install QIIME2 on my Windows 10 machine. I installed Anaconda3, then set up conda to run in Git Bash: echo “. ${PWD}/conda.sh” >> ~/.bashrc Once I restarted Git Bash and activated Conda, I installed python-wget because installation of wget kept getting the following…
main-arm64-default][devel/RStudio] Failed for RStudio-2021.09.1+372 in build
You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: y…@freebsd.org Log URL: ampere2.nyi.freebsd.org/data/main-arm64-default/p7539e33f88ff_s169b368a62/logs/RStudio-2021.09.1+372.log Build URL: ampere2.nyi.freebsd.org/build.html?mastername=main-arm64-default&build=p7539e33f88ff_s169b368a62 Log: =>> Building devel/RStudio build started at Wed Dec 8…
Parallel genomic responses to historical climate change and high elevation in East Asian songbirds
Extreme environments present profound physiological stress. The adaptation of closely related species to these environments is likely to invoke congruent genetic responses resulting in similar physiological and/or morphological adaptations, a process termed “parallel evolution” (1). Existing evidence shows that parallel evolution is more common at the phenotypic level than at…
Transposition and duplication of MADS-domain transcription factor genes in annual and perennial Arabis species modulates flowering
Annual and perennial species occur in many plant families. Annual plants and some perennials are monocarpic (flowering once in their life cycle), characterized by a massive flowering and typically produce many seeds before the whole plant senesces. By contrast, most perennials live for many years, show delayed reproduction, and are…
Issues installing Pindel from git
Issues installing Pindel from git 1 I’m currently attempting to install Pindel on my ubuntu machine (16.04 server), but have been having issues with running the ./INSTALL file. The ./INSTALL file takes the path to htslib as an argument, so I also installed htslib from git with git clone github.com/samtools/htslib…
The Current Molecular Treatment Landscape of Advanced Colorectal Cancer and Need for the COLOMATE Platform
Next-Generation Sequencing Utilizing Tumor Tissue and/or Blood The identification of actionable genomic alterations in tumors such as mCRC was once performed by Sanger DNA sequencing of tumor DNA that was extracted from fixed paraffin-embedded tumor tissue, but this has now been replaced by next-generation sequencing (NGS), which allows for larger-scale…
Genetic basis and adaptation trajectory of soybean from its temperate origin to tropics
Resequencing of soybean accessions from low latitudes To investigate the genomic basis for the natural variation in soybean adaptation to low latitudes, we conducted whole-genome resequencing of a panel of 329 soybean accessions collected from 15 countries and covering all soybean subgroups in which 165 accessions are from in low-latitude…
Accepted r-bioc-deseq2 1.32.0+dfsg-1 (source) into unstable
—–BEGIN PGP SIGNED MESSAGE—– Hash: SHA512 Format: 1.8 Date: Tue, 14 Sep 2021 00:18:17 +0530 Source: r-bioc-deseq2 Architecture: source Version: 1.32.0+dfsg-1 Distribution: unstable Urgency: medium Maintainer: Debian R Packages Maintainers <r-pkg-t…@alioth-lists.debian.net> Changed-By: Nilesh Patra <nil…@debian.org> Changes: r-bioc-deseq2 (1.32.0+dfsg-1) unstable; urgency=medium . [ Andreas Tille ] * Team Upload. * New…
Identification of immunodominant Bartonella bacilliformis proteins: a combined in-silico and serology approach
Introduction Carrión’s disease is a vector-borne biphasic illness restricted to the South American Andes, with Peru as the most affected country. 1 Gomes C Pons MJ Del Valle Mendoza J Ruiz J Carrion’s disease: an eradicable illness?. The causative agent, Bartonella bacilliformis, is transmitted to humans by sandflies (Lutzomyia spp)….
Cutoffs for Proxy Identification: D’ and R^2
Cutoffs for Proxy Identification: D’ and R^2 0 I’m using a proxy-finding script with plink that reports potential proxies with their D’ and R^2: proxy D’ R^2 9:12345698:rs12345 1.0 0.000758121 9:12345999:rs87654 1.0 0.039958 9:12346999:rs54321 1.0 0.0399958 cf. www.cog-genomics.org/plink/2.0/ld However, what cutoffs should be used? From what I’ve read, D’ is…
How to get all genes and their annotations within a LD block?
How to get all genes and their annotations within a LD block? 0 Hi all, Thank you for your help. I identified several significant SNPs with GWAS in wheat. Next, I want to get all the genes form the haploblock where the SNPs reside. Using Emsembl, I was able to…
Please help me understand linkage disequilibrium
I read many explanations about LD but I’m still not comfortable with the explanations. www.youtube.com/watch?v=iH8b-5BxtuY as you can see on these videos, most of them explains as if LD is about the relation between the genotype frequency of parental cell and gametes made from it. But if so, I should…
Sequencing analysis of exons 5 and 6 in RUNX2 in non-syndromic patients with supernumerary tooth in Kelantan, Malaysia
doi: 10.1007/s00784-021-04098-x. Online ahead of print. Affiliations Expand Affiliations 1 Department of Pediatric Dentistry, Hospital Raja Permaisuri Bainun, 30450, Ipoh, Perak, Malaysia. 2 School of Dental Sciences, Universiti Sains Malaysia, 16150, Kubang Kerian, Kelantan, Malaysia. 3 School of Dental Sciences, Universiti Sains Malaysia, 16150, Kubang Kerian, Kelantan, Malaysia. kannan@usm.my. 4…
PLINK Haplotype blocks estimation not working
Hi, I am using PLINK to estimate haplotype blocks using Gabriel’s method. I am using the following command plink –file Chr$PBS_ARRAY_INDEX –noweb –all –blocks –ld-window-kb 500 And it seemed to be working just fine but when job finished no blocks were called at all. The log file does not mention…
The LpoA activator is required to stimulate the peptidoglycan polymerase activity of its cognate cell wall synthase PBP1a
Significance Class A penicillin-binding proteins (aPBPs) assemble the bacterial cell wall and are the targets of penicillin and related β-lactam antibiotics. In gram-negative bacteria, the aPBPs require outer membrane lipoproteins to function. However, little is known about how these proteins promote the activity of their cognate synthases in cells. Here,…
Problem merging data in plink
Problem merging data in plink 1 welcome everybody… In short, this is the error message that appears: Error: 4 variants with 3+ alleles present. If you believe this is due to strand inconsistency, try –flip with merge-merge.missnp. (Warning: if this seems to work, strand errors involving SNPs with A/T or…
smartPCA: problem with .evec file
smartPCA: problem with .evec file 0 Hi all! I’m having problems with .evec file when running smartPCA. This file doesn’t consider all the individuals that I introduced in .ped file (529 individuals). Anyone knows what the problem might be? The command that I used was: ./smartpca -p Patag_sud_maf_ld.par > Patag_sud_maf_ld.out…
Inquiry related to vcf file and formatting
Hello everyone, I am trying to run predixcan software. But its showing error as segmentation fault implying that there is something wrong with my vcf files. I am sharing the header of vcf file. ##fileformat=VCFv4.1 ##INFO=<ID=LDAF,Number=1,Type=Float,Description=”MLE Allele Frequency Accounting for LD”> ##INFO=<ID=AVGPOST,Number=1,Type=Float,Description=”Average posterior probability from MaCH/Thunder”> ##INFO=<ID=RSQ,Number=1,Type=Float,Description=”Genotype imputation quality from…
linkage disequilibrium and haplotype analysis of GWAS .
linkage disequilibrium and haplotype analysis of GWAS . 0 Hi all, I have GWAS data. I have my data in 22 chromosome files in plink format. I have imputed genotype with Sanger imputation server. I use plink for my analysis but because plink 1.9 no more supports –hap…
Error in haploview data format
Error in haploview data format 0 Hi everyone , I’m trying to use haploview software to plot LD for arch chromosomes but I have tassel format data(HapMap) I converted the data to plink format via Tassel (write plink) and I have two files ,Ped file and map file , after…
Calculate LD matrix from bgen file
formatting error: Calculate LD matrix from bgen file 1 Hello, I am new to plink and am learning as I go. I am trying to calculate an LD matrix for a list of variants while using a bgen file as my reference population. See the command below: ./plink2/plink2 –r2 bin…