Tag: MD

Postdoctoral Fellow (Bioinformatics) – Jos Melenhorst Lab

Highly motivated individuals with a PhD or MD/PhD in relevant area are encouraged to apply. This training position, under the direct supervision of a Cleveland Clinic Principal Investigator will provide practical training and experience in a research setting. This position is appointed through the Lerner Research Institute. The successful applicant…

Continue Reading Postdoctoral Fellow (Bioinformatics) – Jos Melenhorst Lab

Front-Line Treatment of DLBCL – NewsBreak

Dr. Lenz on the Rationale for the CheckMate 9X8 in Metastatic CRC Heinz-Josef Lenz, MD, FACP, discusses the rationale for the phase 2/3 CheckMate 9X8 trial in metastatic colorectal cancer. Heinz-Josef Lenz, MD, FACP, associate director, Clinical Research, J. Terrence Lanni Chair in Gastrointestinal Cancer Research, co-director, University of Southern…

Continue Reading Front-Line Treatment of DLBCL – NewsBreak

Senior Bioinformatics Software Developer – Bethesda

Medical Science & Computing, (MSC), a Dovel company, is seeking skilled Senior Bioinformatics Software Developers to join our team supporting our client, NCBI at the National Institutes of Health, (NIH) in Bethesda, MD. The National Center for Biotechnology Information (NCBI) is part of the National Library of Medicine (NLM) at…

Continue Reading Senior Bioinformatics Software Developer – Bethesda

log repeats until it times out)

Your message dated Sat, 22 Jan 2022 21:52:05 +0100 with message-id <f98ce279-5828-d2b5-8b7c-88287a3ab…@debian.org> and subject line Re: Bug#997845: bug 997845 has caused the Debian Bug report #997845, regarding growlight: autopkgtest regression: log repeats until it times out to be marked as done. This means that you claim that the problem has…

Continue Reading log repeats until it times out)

[gmx-users] Why gyration radius keep dropping?

Post by ZHANG ChengDear Gromacs,I am running MD at 500 K for my protein.I used this to analyse the gyration radiusecho 1 | gmx gyrate -s md_0_1.tpr -f md_0_1_noPBC.xtc -o gyrate.xvgI thought the radius should keep increase, as the protein unfolds at high temperature. However, all my repeats showed a…

Continue Reading [gmx-users] Why gyration radius keep dropping?

Pluristyx, panCELLa, and Implant Therapeutics Announce a Strategic Alliance to Manufacture and Distribute Genetically Modified, Clinical-grade Human-induced Pluripotent Stem Cells

SEATTLE–(BUSINESS WIRE)–Pluristyx, Inc., an advanced therapy tools and services biotechnology company, panCELLa, a privately held biotechnology company, and Implant Therapeutics, a developer of genetically engineered stem cells, today announced they have entered into a manufacturing and distribution strategic alliance that offers cell therapy companies streamlined access to the next generation…

Continue Reading Pluristyx, panCELLa, and Implant Therapeutics Announce a Strategic Alliance to Manufacture and Distribute Genetically Modified, Clinical-grade Human-induced Pluripotent Stem Cells

Valine feeding reduces ammonia production through rearrangement of metabolic fluxes in central carbon metabolism of CHO cells

Aghamohseni H, Ohadi K, Spearman M, Krahn N, Moo-Young M, Scharer JM, Butler M, Budman HM (2014) Effects of nutrient levels and average culture pH on the glycosylation pattern of camelid-humanized monoclonal antibody. J Biotechnol 186:98–109. doi.org/10.1016/j.jbiotec.2014.05.024 CAS  Article  PubMed  Google Scholar  Altamirano C, Illanes A, Casablancas A, Gámez X,…

Continue Reading Valine feeding reduces ammonia production through rearrangement of metabolic fluxes in central carbon metabolism of CHO cells

Time-course RNASeq of Camponotus floridanus forager and nurse ant brains indicate links between plasticity in the biological clock and behavioral division of labor | BMC Genomics

1. Sharma VK. Adaptive significance of circadian clocks. Chronobiol Int. 2003;20(6):901–19. PubMed  Google Scholar  2. Paranjpe DA, Sharma VK. Evolution of temporal order in living organisms. J Circadian Rhythms. 2005;3(1):7. PubMed  PubMed Central  Google Scholar  3. Yerushalmi S, Green RM. Evidence for the adaptive significance of circadian rhythms. Ecol Lett….

Continue Reading Time-course RNASeq of Camponotus floridanus forager and nurse ant brains indicate links between plasticity in the biological clock and behavioral division of labor | BMC Genomics

gromacs 2021.5 – Download, Browsing & More

gromacs 2021.5 – Download, Browsing & More | Fossies Archive “Fossies” – the Fresh Open Source Software Archive Contents of gromacs-2021.5.tar.gz (14 Jan 16:58, 38023772 Bytes) About: GROMACS performs molecular dynamics, i.e. simulates the Newtonian equations of motion for systems with hundreds to millions of particles (designed for biochemical molecules…

Continue Reading gromacs 2021.5 – Download, Browsing & More

ggplot2 – R knitr Markdown: Output Plots within For Loop

I am using child Rmd files in markdown, also works in sweave. in Rmd use following snippet: “`{r run-numeric-md, include=FALSE} out = NULL for (i in c(1:num_vars)) { out = c(out, knit_child(‘da-numeric.Rmd’)) } “` da-numeric.Rmd looks like: Variabele `r num_var_names[i]` ———————————— Missing : `r sum(is.na(data[[num_var_names[i]]]))` Minimum value : `r min(na.omit(data[[num_var_names[i]]]))`…

Continue Reading ggplot2 – R knitr Markdown: Output Plots within For Loop

Stream episode Is CAR-T Therapy Superior to ASCT for Relapsed/Refractory DLBCL? by Healthcare Unfiltered podcast

published on 2022-01-11T11:58:44Z Continuing his ASH Annual Meeting coverage, Chadi invites Matt Maurer (@MaurerStats), MS, principal biostatistician, Mayo Clinic, and Alan Skarbnik (@ASkarbnik), MD, director of the lymphoma and CLL program, Novant Health (Charlotte, NC), to review the three prominent CAR-T studies in relapsed/refractory DLBCL presented at the meeting. Why…

Continue Reading Stream episode Is CAR-T Therapy Superior to ASCT for Relapsed/Refractory DLBCL? by Healthcare Unfiltered podcast

Question about MD lammps : comp_chem

Hello everyone, I am trying to model the deposition of a polyelectrolyte on a glass surface to find the time it takes to fully coat the surface. This deposition is based on the difference of charge between the polyelectrolyte and the glass surface. I have created the water model and…

Continue Reading Question about MD lammps : comp_chem

Solved: rsa_varification using mbedtls libs

I was trying to verify a signature of a binary file using mbedtls library (v2.26.0) I took the reference code from github.com/ARMmbed/mbedtls/blob/v2.26.0/programs/pkey/rsa_verify.c  In the reference code, they are using the mbedtls_md_file() function to calculate the hash of the file.But I’m using the FATFS library to access the files. so I had to modify…

Continue Reading Solved: rsa_varification using mbedtls libs

How to build mbedtls for arm gcc

I want to use mbedtls for my stm32 projects, but I have some problems with building. I have to build mbedtls with arm-none-gcc compiler, right? My command is :(in build directory). CC=/home/jareeeeczek/Arczbit/Firmware/ProgramingRelated/ARM_GCC/gcc-arm-none-eabi-10-2020-q4-major/bin/arm-none-eabi-gcc CFLAGS=’-fstack-protector-strong’ cmake -DUSE_SHARED_MBEDTLS_LIBRARY=On ../ and I have error while compiling test program: none-eabi-10-2020-q4-major/bin/arm-none-eabi-gcc CFLAGS=’-fstack-protector-strong’ cmake – DUSE_SHARED_MBEDTLS_LIBRARY=On ../…

Continue Reading How to build mbedtls for arm gcc

NIH Study Shows Using CareDx’s AlloSure Lung for Transplant Surveillance is More Effective than Diagnostic Bronchoscopy at Identifying Rejection

SOUTH SAN FRANCISCO, Calif., Jan. 07, 2022 (GLOBE NEWSWIRE) — CareDx, Inc.,  (Nasdaq: CDNA) – The Transplant Company™ focused on the discovery, development, and commercialization of clinically differentiated, high-value healthcare solutions for transplant patients and caregivers – today announced the results of a study led by the National Institutes of…

Continue Reading NIH Study Shows Using CareDx’s AlloSure Lung for Transplant Surveillance is More Effective than Diagnostic Bronchoscopy at Identifying Rejection

Toll-like receptor 2/4 in Chinese patients with sepsis

Introduction Sepsis is a life-threatening organ dysfunction that results from an exaggerated host immune response to disseminate infection.1 Despite improvements in treatment strategies, sepsis remains a leading cause of death in critically ill patients worldwide.2 Low platelet number, known as thrombocytopenia, is common in infectious diseases (also sometimes referred to…

Continue Reading Toll-like receptor 2/4 in Chinese patients with sepsis

List of software for nanostructures modeling

Three dimensional molecular model of an all-carbon tubular fullerene. This is a list of computer programs that are used to model nanostructures at the levels of classical mechanics[1] and quantum mechanics. Ascalaph Designer Atomistix ToolKit and Virtual NanoLab[2] CST Studio Suite[3] CoNTub Deneb[4] – graphical user interface (GUI) for SIESTA,…

Continue Reading List of software for nanostructures modeling

Sr. Manager of Manufacturing – Resumetojobs.com

NuProbe USA is seeking an experienced Sr. Manager, In-Vitro Diagnostics Operations who will be responsible for all aspects of manufacturing, including design transfer of newly developed products from research & development. The successful candidate will control production planning, scheduling and forecasting. The candidate will lead continuous improvements in manufacturing as…

Continue Reading Sr. Manager of Manufacturing – Resumetojobs.com

[Buildroot] [PATCH 1/2] package/mbedtls3: new package

[Buildroot] [PATCH 1/2] package/mbedtls3: new package * [Buildroot] [PATCH 1/2] package/mbedtls3: new package @ 2021-12-28 15:33 Fabrice Fontaine 2021-12-28 15:33 ` [Buildroot] [PATCH 2/2] package/hiawatha: needs mbedtls3 Fabrice Fontaine 2021-12-28 15:49 ` [Buildroot] [PATCH 1/2] package/mbedtls3: new package Thomas Petazzoni 0 siblings, 2 replies; 5+ messages in thread From: Fabrice…

Continue Reading [Buildroot] [PATCH 1/2] package/mbedtls3: new package

Structure relaxation using SIESTA : comp_chem

I want to relax an interface using SIESTA with a method similar to ISIF = 2 in VASP. However, SIESTA has the following options for relaxation, MD.VariableCell = which is analogous to ISIF = 3 in VASP, Constant.Volume = which is analogous to ISIF = 4 in VASP and MD.RelaxCellOnly…

Continue Reading Structure relaxation using SIESTA : comp_chem

La Jolla Institute for Immunology hiring Bioinformatics Postdoc – Systems Immunology of Infectious Diseases in San Diego, California, United States

The Peters Lab at the La Jolla Institute for Immunology (LJI) is looking for a bioinformatics postdoc to join our efforts in profiling immune system responses to a variety of infectious agents, such as M. tuberculosis and B. Pertussis, as well as various cancers. Qualified applicants will have the opportunity…

Continue Reading La Jolla Institute for Immunology hiring Bioinformatics Postdoc – Systems Immunology of Infectious Diseases in San Diego, California, United States

Visualisation for MD simulations data : comp_chem

I’m a second year phd student running mostly orca calculations on a range of MOFs and quantifying their properties (mostly reaction free energies of adsorption for small molecules). However, from next year I’ll be running some MD simulations to track diffusion of ions through MOF pores. I’m already familiar with…

Continue Reading Visualisation for MD simulations data : comp_chem

NIH-SOAR-NCI-Bioinformatics Scientist in Rockville, MD

Axle Informatics is a bioscience and information technology company that offers advancements in translational research, biomedical informatics, and data science applications to research centers and healthcare organizations around the globe. With experts in biomedical science, software engineering, and program management, we focus on developing and applying research tools and techniques…

Continue Reading NIH-SOAR-NCI-Bioinformatics Scientist in Rockville, MD

Support for unevaluatedProperties in OAS 3.1+? – JavaScript OpenAPI-Specification

The latest (draft 2020-12) version of JSON Schema supports the unevaluatedProperties vocabulary (see here). This is quite a useful feature, and facilitates stricter validation while composing properties from multiple sub-schemas (using e.g. allOf) than would otherwise possible. Looking through the issue history, I’ve seen a couple mentions of incorporating unevaluatedProperties…

Continue Reading Support for unevaluatedProperties in OAS 3.1+? – JavaScript OpenAPI-Specification

Characterization of Blood- Based Molecular Profiling in Pancreatic Adenocarcinoma

Introduction Most cases of pancreatic adenocarcinoma (PDAC) are diagnosed in the metastatic or locally advanced stage. It is the fourth leading cause of cancer death in the United States,1,2 with a 5-year overall survival (OS) around 10% in this country2 despite years of research and therapeutic development. For those patients…

Continue Reading Characterization of Blood- Based Molecular Profiling in Pancreatic Adenocarcinoma

Brem Looks at Multiple Treatments for Patients With DLBCL

During a Targeted OncologyTM Case-Based Roundtable event, Elizabeth A. Brem, MD, an assistant professor in Division of Hematology/Oncology, Department of Medicine at UC Irvine Health in Los Angeles, CA, moderated a discussion about a 43-year-old woman with diffuse large B-cell lymphoma. Targeted Oncology™: What therapeutic options would you consider at…

Continue Reading Brem Looks at Multiple Treatments for Patients With DLBCL

LAMMPS failed to install with Intel compiler due to cpio and diffutils

$ spack install lammps%intel +asphere +class2 +kspace +manybody +misc +molecule +mpiio +opt +replica +rigid +user-omp +user-intel ^intel-mkl ^intel-mpi (base) bash-4.2$ spack install lammps%intel +asphere +class2 +kspace +manybody +misc +molecule +mpiio +opt +replica +rigid +user-omp +user-intel ^intel-mkl ^intel-mpi [+] /opt/intel/cmake (external cmake-3.20.0-3teotjsa6webcsazofydfkk2v3pn2hb6) [+] /nfs/pdx/home/sdouyeb/spack/opt/spack/linux-centos7-skylake_avx512/intel-19.1.3.304/alsa-lib-1.2.3.2-yctbppr2tcdayclbt32xjgagmmwbct2v [+] /nfs/pdx/home/sdouyeb/spack/opt/spack/linux-centos7-skylake_avx512/intel-19.1.3.304/libiconv-1.16-ilxedtsoqggtmtbrjxehh6ojznmtdni3 [+] /nfs/pdx/home/sdouyeb/spack/opt/spack/linux-centos7-skylake_avx512/intel-19.1.3.304/yasm-1.3.0-7y4fvxshqkmikii3cvelccaiajj4dboc [+] /nfs/pdx/home/sdouyeb/spack/opt/spack/linux-centos7-skylake_avx512/intel-19.1.3.304/zlib-1.2.11-k24vg36ubsrvwfgrdipndmpqn4eo5jq7 ==>…

Continue Reading LAMMPS failed to install with Intel compiler due to cpio and diffutils

molecular dynamics – How to choose appropriate energy term in GROMACS MD simulation (Lennard-Jones or Coulomb)?

Which is more appropriate for the binding energy? Neither. Obi-Wan voice: “These are not the energies you’re looking for.” If I understand your goal, you’re trying to compare two ligands and determine which is better at binding to a given protein (and, ideally, quantify “how much better” one is compared…

Continue Reading molecular dynamics – How to choose appropriate energy term in GROMACS MD simulation (Lennard-Jones or Coulomb)?

Barriers to Loncastuximab Before CAR T-Cell Therapy in DLBCL

DISCUSSION QUESTIONS Do you foresee any barriers to using loncastuximab tesirine (Zynlonta) in diffuse large B-cell lymphoma (DLBCL)?​ If loncastuximab were covered by insurance, would you use it in the second line for patients who decline transplant?​ DEVA NATHAN, MD: I have different question. Are you willing to replace R-CHOP [rituximab…

Continue Reading Barriers to Loncastuximab Before CAR T-Cell Therapy in DLBCL

molecular dynamics – How to manage disk space for Gromacs XTC (trajectory) file output

Is there an option in gmx mdrun to specify where to write the .xtc file? For example I want to specify specific directory path with large disk space. When you use the -deffnm md argument to gmx mdrun, it is assumed that all of the files will have the base…

Continue Reading molecular dynamics – How to manage disk space for Gromacs XTC (trajectory) file output

speed slow down on running CP2K

Dear All I am newbie in CP2K and trying to run MD simulation on the benzene-water cluster with BLYP functional. I found a strange phenomenon when I check one of the NVE output files with the filename extension of .ener. The CPU time slowed down significantly after step 12283 and…

Continue Reading speed slow down on running CP2K

GeneTonic: an R/Bioconductor package for streamlining the interpretation of RNA-seq data | BMC Bioinformatics

1. Van den Berge K, Hembach KM, Soneson C, Tiberi S, Clement L, Love MI, Patro R, Robinson MD. RNA sequencing data: Hitchhikers guide to expression analysis. Annu Rev Biomed Data Sci. 2019;2(1):139–73. doi.org/10.1146/annurev-biodatasci-072018-021255. Article  Google Scholar  2. Conesa A, Madrigal P, Tarazona S, Gomez-Cabrero D, Cervera A, McPherson A,…

Continue Reading GeneTonic: an R/Bioconductor package for streamlining the interpretation of RNA-seq data | BMC Bioinformatics

Real-World Assessment of Patient Care and Practice Efficiency With the Introduction of Subcutaneous Rituximab

Introduction Rituximab (Rituxan; Genentech) is a chimeric anti-CD20 monoclonal antibody widely used in non-Hodgkin lymphoma (NHL) treatment.1 Worldwide, rituximab is recommended for a variety of B-cell malignancies,1,2 and it has a well-established efficacy and safety profile, with more than 4 million patients treated.1,3 In the United States, rituximab is approved…

Continue Reading Real-World Assessment of Patient Care and Practice Efficiency With the Introduction of Subcutaneous Rituximab

The Future of Targeted Therapies in DLBCL

In an interview with Targeted Oncology, Thomas Habermann, MD discusses the current unmet needs in the DLBCL space, along with the future of targeted therapies. While rituximab (Rituxan), cyclophosphamide, doxorubicin, vincristine, and prednisone (R-CHOP) is a highly effective therapy for diffuse large B-cell lymphoma (DLBCL). However, major unmet clinical needs still exist for patients with…

Continue Reading The Future of Targeted Therapies in DLBCL

BioSpace hiring Bioinformatics Scientist in Bethesda, Maryland, United States

We are currently searching for a Bioinformatics Scientist to provide support services to satisfy the overall operational objectives of the Center for Alzheimer’s and Related Dementias, National Institute on Aging. The primary objective is to provide services and deliverables through performance of support services. This opportunity is full-time, and it…

Continue Reading BioSpace hiring Bioinformatics Scientist in Bethesda, Maryland, United States

[100% Off UDEMY Coupon] – Molecular Dynamic Simulation on Gromacs Software –

Using this 100% off UDEMY Free Coupon Code, you can able to enroll the course: Molecular Dynamic Simulation on Gromacs Software for Free on Udemy.This is a UDEMY Free Promo Code this is totally Free for a Limited Time so enroll soon as possible Molecular Dynamics Simulations ,Gromacs Software ,MD…

Continue Reading [100% Off UDEMY Coupon] – Molecular Dynamic Simulation on Gromacs Software –

Dryad Data — Lichen fungi do not depend on the alga for ATP production

Lichen fungi live in a symbiotic association with unicellular phototrophs and have no known aposymbiotic stage. A recent study postulated that some of them have lost mitochondrial oxidative phosphorylation and rely on their algal partners for ATP. This claim originated from an apparent lack of ATP9, a gene encoding one subunit…

Continue Reading Dryad Data — Lichen fungi do not depend on the alga for ATP production

CMT2 Research Projects Launched by CMTA Seed Money Win NIH Funds

Two research projects focused on developing gene-editing therapies for Charcot-Marie-Tooth disease type 2 (CMT2) — both launched with seed monies from the Charcot-Marie-Tooth Association-Strategy to Accelerate Research (CMTA-STAR) program — have now been awarded additional funding from the National Institutes of Health (NIH). According to a CMTA press release, these NIH…

Continue Reading CMT2 Research Projects Launched by CMTA Seed Money Win NIH Funds

CN Partners with Google Cloud to Modernize Railway Services and Deliver Enhanced Customer Experiences

Seven-year partnership will enable CN’s strategic plan, powering sustainable growth over the coming decade for customers, people, and communities MONTRÉAL and SUNNYVALE, Calif., Dec. 14, 2021 /PRNewswire/ — CN (TSX: CNR) (NYSE: CNI), a world-class transportation leader and trade-enabler serving North America, and Google Cloud today announced a seven-year strategic partnership…

Continue Reading CN Partners with Google Cloud to Modernize Railway Services and Deliver Enhanced Customer Experiences

MSK Chief of the Lymphoma Service Gilles Sall

December 14, 2021, NEW YORK, NY – A study from Memorial Sloan Kettering Cancer Center (MSK) published today in the New England Journal of Medicine (NEJM), found that in patients with previously untreated Diffuse Large B-Cell Lymphoma (DLBCL) Polatuzumab vedotin with Rituximab, Cyclophosphamide, Doxorubicin, and Prednisone (pola-R-CHP) resulted in a…

Continue Reading MSK Chief of the Lymphoma Service Gilles Sall

Promising new treatment for patients with diffuse large B-cell lymphoma

Hodgkin lymphoma, nodular lymphocyte predominant (high-power view) Credit: Gabriel Caponetti, MD./Wikipedia/CC BY-SA 3.0 A study from Memorial Sloan Kettering Cancer Center (MSK) published today in the New England Journal of Medicine (NEJM), found that in patients with previously untreated Diffuse Large B-Cell Lymphoma (DLBCL) Polatuzumab vedotin with Rituximab, Cyclophosphamide, Doxorubicin,…

Continue Reading Promising new treatment for patients with diffuse large B-cell lymphoma

Real-World Study of Tisagenlecleucel in R/R B-Cell Non-Hodgkin Lymphomas Shows Efficacy, Safety

Real-world data on tisagenlecleucel in patients with relapsed/refractory B-cell lymphoma was consistent with the phase 2 JULIET trial, demonstrating favorable efficacy and safety. Real-world data on the use of tisagenlecleucel (Kymriah) showed greater efficacy and a favorable safety profile, according to updated findings from a study of the Center for…

Continue Reading Real-World Study of Tisagenlecleucel in R/R B-Cell Non-Hodgkin Lymphomas Shows Efficacy, Safety

[BUG] (python-fastapi) OneOf class not generated

Bug Report Checklist Description For oneOf fields, the python-fastapi server generator creates a function that returns a OneOf* class, but that class itself is not generated. For example, for an API like /status: get: summary: Get the status of the upstream server responses: 200: description: successful operation content: application/json: schema:…

Continue Reading [BUG] (python-fastapi) OneOf class not generated

Tafasitamab and Lenalidomide Combo Yields Higher OS vs Standard Options in Relapsed/Refractory DLBCL

Treatment with tafasitamab (Monjuvi) and lenalidomide (Revlimid) provided an overall survival (OS) benefit vs standard options in a population of patients with autologous stem cell transplant (ASCT)–ineligible relapsed/refractory diffuse large B-cell lymphoma (DLBCL), according to findings from an expanded analysis of RE-MIND2 study (NCT04697160) that was presented at the 2021…

Continue Reading Tafasitamab and Lenalidomide Combo Yields Higher OS vs Standard Options in Relapsed/Refractory DLBCL

Improving IR, UV/vis and NMR calculations by CRE sampling : comp_chem

TL;DR: I try to learn how to improve the prediction of spectra (mainly IR, UV/vis and NMR) and calculate Boltzmann weights from iMTD-GC calculations using CREST and I don’t really understand the software’s output. First question is for my comprehension, second one CREST specific, 3-5 general questions. CREST has been…

Continue Reading Improving IR, UV/vis and NMR calculations by CRE sampling : comp_chem

Loncastuximab Tesirine Plus Ibrutinib on Relapsed DLBCL Trends Favorable to LOTIS-3 Interim Analysis

A preliminary review of the current phase 2 LOTIS-3 trial (NCT03684694) presented at the 2021 American Society of Hematology (ASH) Annual Meeting revealed promising efficacy and encouraging safety in the combination of ibrutinib (Imbruvica) and loncastuximab tesirine (Zynlonta ) in patients with relapsed/refractory (R/R) disseminated large B-cell lymphoma (DLBCL). These…

Continue Reading Loncastuximab Tesirine Plus Ibrutinib on Relapsed DLBCL Trends Favorable to LOTIS-3 Interim Analysis

Sr Scientist – IVD Development – Houston

NuProbe USA Inc . is looking for a Staff/Senior Scientist to lead the IVD project development program at NuProbe to support both research and in vitro diagnostic (IVD) assays for use in medical research, clinical trials, regulatory submissions, and clinical diagnostic use.  NuProbe USA is a rapidly growing company and…

Continue Reading Sr Scientist – IVD Development – Houston

Articulated Neural Radiance Fields for Learning Human Shape, Appearance, and Pose

A-NeRF: Articulated Neural Radiance Fields for Learning Human Shape, Appearance, and PoseShih-Yang Su, Frank Yu, Michael Zollhรถfer, and Helge RhodinThirty-Fifth Conference on Neural Information Processing Systems (NeurIPS 2021) Setup Setup environment conda create -n anerf python=3.8 conda activate anerf # install pytorch for your corresponding CUDA environments pip install torch…

Continue Reading Articulated Neural Radiance Fields for Learning Human Shape, Appearance, and Pose

Liso-Cel Yields EFS Benefit as Second-line Therapy in LBCL

The phase 3 TRANSFORM study (NCT03575351) showed that patients with relapsed or refractory large B-cell lymphoma (LBCL) had a clinically meaningful improvement in event-free survival (EFS) compared with the standard of care (SOC) when treated with liscocabtagene maraleucel (liso-cel), according to prespecified interim results that were presented at the 2021…

Continue Reading Liso-Cel Yields EFS Benefit as Second-line Therapy in LBCL

Loncastuximab Tesirine Plus Ibrutinib in Relapsed DLBCL Trends Favorably at LOTIS-3 Interim Analysis – NewsTVPK

An interim analysis of the ongoing phase 2 LOTIS-3 trial (NCT03684694), which was presented at the 2021 Annual Meeting of the American Society of Hematology (ASH), revealed promising efficacy and encouraging safety with the combination of ibrutinib (Imbruvica) plus loncastuximab thesis (Zynlonta) in patients with recurrent / resistant (R /…

Continue Reading Loncastuximab Tesirine Plus Ibrutinib in Relapsed DLBCL Trends Favorably at LOTIS-3 Interim Analysis – NewsTVPK

Epizyme Presents Preclinical Data and Phase 1/1b Trial Design on the Company’s SETD2 Inhibitor, EZM0414, at the 2021 ASH Annual Meeting

CAMBRIDGE, Mass., December 11, 2021–(BUSINESS WIRE)–Epizyme, Inc. (Nasdaq: EPZM), a fully integrated, commercial-stage biopharmaceutical company developing and delivering transformative therapies against novel epigenetic targets, today shared preclinical data and the Phase 1/1b trial design for EZM0414, the Company’s novel, first-in-class, oral SETD2 inhibitor, an investigational agent being developed for the…

Continue Reading Epizyme Presents Preclinical Data and Phase 1/1b Trial Design on the Company’s SETD2 Inhibitor, EZM0414, at the 2021 ASH Annual Meeting

Liso-cel significantly improves outcomes in second-line DLBCL

December 11, 2021 2 min read Source/Disclosures Published by: Source: Kamdar M, et al. Abstract 91. Presented at: ASH Annual Meeting and Exposition; Dec. 11-14, 2021. Disclosures: Kamdar reports consultant/advisory or speakers bureau roles with AbbVie, Adaptive Biotechnologies, ADC Therapeutics, AstraZeneca, Bristol Myers Squibb, Celgene, Genentech, Karyopharm…

Continue Reading Liso-cel significantly improves outcomes in second-line DLBCL

EFS improvement with axi-cel CAR-T a ‘breakthrough’ in second-line treatment of DLBCL

December 11, 2021 3 min read Source/Disclosures Published by: Source: Locke FL, et al. Abstract 2. Presented at: ASH Annual Meeting and Exposition; Dec. 11-14, 2021. Disclosures: Kite Pharma sponsored this study. Leslie reports advisory board, consultant or speakers bureau roles with AbbVie, AstraZeneca, BeiGene, Celgene/Bristol Myers…

Continue Reading EFS improvement with axi-cel CAR-T a ‘breakthrough’ in second-line treatment of DLBCL

Tafasitamab/Lenalidomide Improves OS Over Other Options in Retrospective Relapsed/Refractory DLBCL

The combination of tafasitamab (Monjuvi) and lenalidomide (Revlimid) prolonged median overall survival (OS) compared with other standard options for autologous stem cell transplant (ASCT)-ineligible patients with relapsed/refractory (R/R) diffuse large B-cell lymphoma (DLBCL), according to a closely matched expanded analysis of the observational, retrospective RE-MIND2 (NCT04697160) study presented at the…

Continue Reading Tafasitamab/Lenalidomide Improves OS Over Other Options in Retrospective Relapsed/Refractory DLBCL

Loncastuximab Tesirine/Ibrutinib Combination Elicits Encouraging Activity in Relapsed/Refractory DLBCL

Treatment with ibrutinib plus loncastuximab tesirine-lpyl resulted in high objective and complete response rates and an acceptable safety profile in patients with relapsed/refractory diffuse large B-cell lymphoma, according to findings from an interim analysis of the phase 1/2 LOTIS-3 trial (NCT03684694) that were presented at the 2021 ASH Annual Meeting…

Continue Reading Loncastuximab Tesirine/Ibrutinib Combination Elicits Encouraging Activity in Relapsed/Refractory DLBCL

Easy OpenAPI specs and Swagger UI for your Flask API

Easy Swagger UI for your Flask API Flasgger is a Flask extension to extract OpenAPI-Specification from all Flask views registered in your API. Flasgger also comes with SwaggerUI embedded so you can access localhost:5000/apidocs and visualize and interact with your API resources. Flasgger also provides validation of the incoming data,…

Continue Reading Easy OpenAPI specs and Swagger UI for your Flask API

The ENmix DNA methylation analysis pipeline for Illumina BeadChip and comparisons with seven other preprocessing pipelines | Clinical Epigenetics

Methylation analysis pipelines The ENmix pipeline performs data preprocessing in a stepwise way, including ENmix background correction [1], RELIC dye bias correction [3], optional inter-array normalization, RCP probe-type bias correction [2], quality control, filtering of low-quality data points, and imputation. ENmix background correction employs a mixture of exponential and truncated…

Continue Reading The ENmix DNA methylation analysis pipeline for Illumina BeadChip and comparisons with seven other preprocessing pipelines | Clinical Epigenetics

BioSpace hiring Bioinformatics Python Developer in Rockville, Maryland, United States

We are currently searching for a Bioinformatics Python Developer to provide support to the National Institutes of Health (NIH). This opportunity is a permanent, full-time position with MSC, and it is on-site in Rockville, MD. Duties & Responsibilities The role will be responsible for developing and extending software solutions for…

Continue Reading BioSpace hiring Bioinformatics Python Developer in Rockville, Maryland, United States

AWS SAM :: AWS::Serverless::Api “Invalid value for ‘Auth’ property”

I’ve managed to define a template for a Lambda behind an API GW authenticated via (dedicated) ApiKey by describing everything in the template and with no OpenApi definition. The problem arises when trying to introduce Lambda Integrations for accomplishing the mappings: it seems that they can be defined only in…

Continue Reading AWS SAM :: AWS::Serverless::Api “Invalid value for ‘Auth’ property”

BRCA2 Linked to Inferior Outcomes of Treatment With CDK4/6 Inhibitors Plus Endocrine Therapy

An analysis of germline-somatic interactions in breast cancer tumors revealed novel associations relevant to the disease’s progression and treatment resistance. For example, the study presented at the 2021 San Antonio Breast Cancer Symposium (SABCS) showed that carriers of the BRCA2 mutation had inferior outcomes to treatment with first-line CDK4/6 inhibitors…

Continue Reading BRCA2 Linked to Inferior Outcomes of Treatment With CDK4/6 Inhibitors Plus Endocrine Therapy

python – How does one install PyTorch and related tools from within the setup.py install_requires list?

I was trying to test the pip install -e . on my library ultimate-utils after changing laptops but I keep getting errors of this type: (uutils_env) brandomiranda~/ultimate-utils ❯ pip install -e . Obtaining file:///Users/brandomiranda/ultimate-utils Preparing metadata (setup.py) … done ERROR: Could not find a version that satisfies the requirement torchvision==0.10.1…

Continue Reading python – How does one install PyTorch and related tools from within the setup.py install_requires list?

New biosensors shine a light on CRISPR gene editing — ScienceDaily

Detecting the activity of CRISPR gene editing tools in organisms with the naked eye and an ultraviolet flashlight is now possible using technology developed at the Department of Energy’s Oak Ridge National Laboratory. Scientists demonstrated these real-time detection tools in plants and anticipate their use in animals, bacteria and fungi…

Continue Reading New biosensors shine a light on CRISPR gene editing — ScienceDaily

The Evolving Treatment Landscape of Cholangiocarcinoma

Recent genomic profiling studies revealed that approximately 40% of patients with biliary tract cancers harbor actionable genomic mutations. The advances in the understanding and characterization of biliary tract cancers (BTCs), particularly intrahepatic cholangiocarcinoma (iCCA), and genomic profiling over the past decade have led to a rapid expansion of available treatment…

Continue Reading The Evolving Treatment Landscape of Cholangiocarcinoma

Pola-G-Len Regimen Shows Promise as an Alternative to CAR T Cells in Refractory FL

The combination of obinutuzumab (Gazyva) with polatuzumab vedotin (Polivy) or lenalidomide (Revlimid; Pola-G-Len) achieved high responses in patients with heavily pretreated refractory follicular lymphoma (FL) in a phase 1b/2 clinical trial. “Our findings demonstrated that the regimen of Pola-G-Len was safe and had a high level of activity in relapsed…

Continue Reading Pola-G-Len Regimen Shows Promise as an Alternative to CAR T Cells in Refractory FL

Extracting Number of SNPs via parsing MD tags

Hello all, I’m having a bit of difficulty wrapping my head around a task involving extracting the total number of SNPs from an alignment via creating a string parser/grep command which would be able to extract only the SNPs and ignoring indels. I am currently using a python script utilising…

Continue Reading Extracting Number of SNPs via parsing MD tags

Can anyone help with understanding this Molecular Dynamics Simulations (in FORTRAN) problem? : comp_chem

I have the code with me. But I’m not able to interpret the results. I’m not even sure I understand the code in its full entirety. I’ll attach the code as well for your understanding. Please help me out with this. Please. Q1. Write A molecular dynamics code interacting with…

Continue Reading Can anyone help with understanding this Molecular Dynamics Simulations (in FORTRAN) problem? : comp_chem

Greenwich LifeSciences Announces Presentation of 5 Year Data for GP2 Phase IIb Clinical Trial, Revealing Potential For New T Cell Platform Technology

STAFFORD, Texas–(BUSINESS WIRE)–Greenwich LifeSciences, Inc. (Nasdaq: GLSI) (the “Company”), a clinical-stage biopharmaceutical company focused on the development of GP2, an immunotherapy to prevent breast cancer recurrences in patients who have previously undergone surgery, today announced the publication of a poster for the GP2 Phase IIb clinical trial at the San…

Continue Reading Greenwich LifeSciences Announces Presentation of 5 Year Data for GP2 Phase IIb Clinical Trial, Revealing Potential For New T Cell Platform Technology

Denovo Biopharma and QIAGEN partner to develop companion diagnostic test for the treatment of Diffuse Large B-Cell Lymphoma (DLBCL)

– QIAGEN’s blood-based test will help to identify patients with Diffuse Large B-Cell Lymphoma (DLBCL) likely to respond to Denovo’s new investigational cancer treatment DB102 – The partners seek FDA premarket approval (PMA) of the companion diagnostic test in tandem with the new drug application (NDA) approval. SAN DIEGO and…

Continue Reading Denovo Biopharma and QIAGEN partner to develop companion diagnostic test for the treatment of Diffuse Large B-Cell Lymphoma (DLBCL)

Frontiers | The cGAS-STING Pathway: A Promising Immunotherapy Target

Introduction Invaded by exogenous or endogenous pathogens, the host immune system will be activated accordingly to resist harm and maintain homeostasis, which includes innate immunity and adaptive immunity. As the first line of host immune defense, innate immunity plays a critical role in recognizing extracellular and intracellular pathogens (1, 2)….

Continue Reading Frontiers | The cGAS-STING Pathway: A Promising Immunotherapy Target

Reliability of Cell-Free DNA (cfDNA) Next Generation Sequencing in Predicting Chromosomal Structural Abnormalities and Cytogenetic-Risk Stratification of Patients with Myeloid Neoplasms

Oral and Poster Abstracts 617. Acute Myeloid Leukemias: Biomarkers, Molecular Markers and Minimal Residual Disease in Diagnosis and Prognosis: Poster III Translational Research Maher Albitar, MD1*, Andrew Ip, MD, MSc2, Andre H. Goy, MD3*, Jeffrey Justin Estella, BS, MS1*, Ivan De Dios, BS1*,…

Continue Reading Reliability of Cell-Free DNA (cfDNA) Next Generation Sequencing in Predicting Chromosomal Structural Abnormalities and Cytogenetic-Risk Stratification of Patients with Myeloid Neoplasms

Part 1: Choosing a Third-Line Treatment for Refractory DLBCL

DISCUSSION QUESTION What are the key factors that influence your decision making for third-line therapy? PAOLO CAIMI, MD: What are the key factors that influence your decision in choice of regimen for patients who are in the third-line therapy? Any comments about the things that you use when you’re thinking…

Continue Reading Part 1: Choosing a Third-Line Treatment for Refractory DLBCL

Illumina Supports Norway’s Pioneering Precision Medicine Study

SAN DIEGO, Dec. 9, 2021 /PRNewswire/ — Illumina, Inc. (NASDAQ:ILMN), today announced that it is supporting a national precision medicine study in Norway to assess the efficacy of blood-based comprehensive genomic profiling (CGP) in cancer therapy selection testing. The study will also evaluate the cost-effectiveness of implementing blood-based CGP in…

Continue Reading Illumina Supports Norway’s Pioneering Precision Medicine Study

QIAGEN and Denovo Biopharma Partner to Develop Companion Diagnostic Test for the Treatment of Diffuse Large B-Cell Lymphoma (DLBCL)

QIAGEN’s blood-based test will help to identify patients with Diffuse Large B-Cell Lymphoma (DLBCL) likely to respond to Denovo’s new investigational cancer treatment DB102TM The partners seek FDA premarket approval (PMA) of the companion diagnostic test in tandem with the new drug application (NDA) approval. New master collaboration agreement adds…

Continue Reading QIAGEN and Denovo Biopharma Partner to Develop Companion Diagnostic Test for the Treatment of Diffuse Large B-Cell Lymphoma (DLBCL)

Postdoctoral Fellow job with Cleveland Clinic – Genomic Medicine Institute

We are seeking multiple Experimental and Bioinformatics research positions (including Postdoctoral Research Fellows and Research Associate) to join the Alzheimer’s Network Medicine and Artificial Intelligence (AI) research group (www.lerner.ccf.org/gmi/cheng/) led by Dr. Feixiong Cheng at the Genomic Medicine Institute, Cleveland Clinic Lerner Research Institute, and Department of Molecular Medicine at…

Continue Reading Postdoctoral Fellow job with Cleveland Clinic – Genomic Medicine Institute

main-arm64-default][devel/RStudio] Failed for RStudio-2021.09.1+372 in build

You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: y…@freebsd.org Log URL: ampere2.nyi.freebsd.org/data/main-arm64-default/p7539e33f88ff_s169b368a62/logs/RStudio-2021.09.1+372.log Build URL: ampere2.nyi.freebsd.org/build.html?mastername=main-arm64-default&build=p7539e33f88ff_s169b368a62 Log: =>> Building devel/RStudio build started at Wed Dec 8…

Continue Reading main-arm64-default][devel/RStudio] Failed for RStudio-2021.09.1+372 in build

In some lymphomas, ibrutinib yields “almost unheard-of” survival rates

Younger patients with two genetic subtypes of diffuse large B cell lymphoma (DLBCL) – specifically MCD and N1 – show substantial improvements in survival with the addition of ibrutinib to standard R-CHOP chemotherapy, compared with R-CHOP alone, new research shows. The findings, published Nov. 4, 2021, in Cancer Cell, come…

Continue Reading In some lymphomas, ibrutinib yields “almost unheard-of” survival rates

MD Anderson research highlights 9 December

ATLANTA ― The University of Texas MD Anderson Cancer Center‘s Research Highlights provides a glimpse into basic, translational and clinical cancer research from MD Anderson experts. This special edition features presentations at the 2021 American Society of Hematology (ASH) Annual Meeting on innovative targeted therapies, new combination approaches, and novel…

Continue Reading MD Anderson research highlights 9 December

Bioinformatics Scientist – Bethesda | Mendeley Careers

We are currently searching for a Bioinformatics Scientist to provide support services to satisfy the overall operational objectives of the National Human Genome Research Institute (NHGRI), The primary objective is to provide services and deliverables through performance of support services. This opportunity is full-time, and it is on site in…

Continue Reading Bioinformatics Scientist – Bethesda | Mendeley Careers

Identification of Hub Genes in Patients with Alzheimer Disease and Obs

Introduction Alzheimer’s disease (AD) ranks first among the common dementia type of the world. According to epidemiological investigation from the International Alzheimer’s disease association, about 45 million people has been suffered from AD, and the number is expected to increase to 131 million in 2050.1 Despite the widespread prevalence of…

Continue Reading Identification of Hub Genes in Patients with Alzheimer Disease and Obs

Choosing a Third-Line Treatment for Refractory DLBCL

DISCUSSION QUESTION What are the key factors that influence your decision making for third-line therapy? PAOLO CAIMI, MD: What are the key factors that influence your decision in choice of regimen for patients who are in the third-line therapy? Any comments about the things that you use when you’re thinking about…

Continue Reading Choosing a Third-Line Treatment for Refractory DLBCL

Repo template to use a Linux Desktop Application on a binder / jupyterhub

Generate a Git repository that can run any Linux GUI application in the browser via mybinder.org or any JupyterHub from this template repository! Uses jupyter-remote-desktop-proxy to work. How to use this reop 1. Create a new repo using this as a template Use the Use this template button on GitHub….

Continue Reading Repo template to use a Linux Desktop Application on a binder / jupyterhub

Brazil opens a new genome sequencing center; Know what the plans are

The Ministry of Health inaugurated on Monday (6) a Brazilian Genome Sequencing Research Center. This initiative is part of the Genomes Brasil program, which was created to sequence the DNA of 100,000 Brazilians and help diagnose and treat rare and complex diseases, such as cancer and cardiovascular disease. This is…

Continue Reading Brazil opens a new genome sequencing center; Know what the plans are

Common and rare variant association analyses in amyotrophic lateral sclerosis identify 15 risk loci with distinct genetic architectures and neuron-specific biology

Department of Neurology, UMC Utrecht Brain Center, University Medical Center Utrecht, Utrecht University, Utrecht, the Netherlands Wouter van Rheenen, Rick A. A. van der Spek, Mark K. Bakker, Joke J. F. A. van Vugt, Paul J. Hop, Ramona A. J. Zwamborn, Annelot M. Dekker, Klara Gawor, Henk-Jan Westeneng, Gijs H. P. Tazelaar, Kristel R. van Eijk, Maarten Kooyman, Ewout J. N. Groen, Michael…

Continue Reading Common and rare variant association analyses in amyotrophic lateral sclerosis identify 15 risk loci with distinct genetic architectures and neuron-specific biology

GeneDx Announces the Sequencing of More Than 300,000 Clinical Patient Exomes

GAITHERSBURG, Md., Sept. 21, 2021 /PRNewswire/ — GeneDx, Inc., a leader in genomic analysis, a wholly owned subsidiary of BioReference Laboratories, Inc., an OPKO Health company (NASDAQ: OPK), today announced it has completed clinical genetic exome sequencing for more than 300,000 patients, making the company’s dataset the largest of its kind…

Continue Reading GeneDx Announces the Sequencing of More Than 300,000 Clinical Patient Exomes

GeneDx Announces the Sequencin – GuruFocus.com

GAITHERSBURG, Md., Sept. 21, 2021 GAITHERSBURG, Md., Sept. 21, 2021 /PRNewswire/ — GeneDx, Inc., a leader in genomic analysis, a wholly owned subsidiary of BioReference Laboratories, Inc., an OPKO Health company (NASDAQ:OPK), today announced it has completed clinical genetic exome sequencing for more than 300,000 patients, making the company’s dataset…

Continue Reading GeneDx Announces the Sequencin – GuruFocus.com

miRNAs and mRNAs in intestinal ischemia-reperfusion injury

Introduction Intestinal ischemia-reperfusion (II/R) injury is a severe clinical complication common in the Intensive Care Unit (ICU). It is associated with high morbidity and mortality.1 Usually, this problem is followed by various causes, including sepsis, shock, trauma, and so on.2 Intestinal ischemia-reperfusion injury destroys intestinal tissue and impairs the function…

Continue Reading miRNAs and mRNAs in intestinal ischemia-reperfusion injury

hypothetical protein DAPPUDRAFT_213302, maker-scaffold2255_size18018-snap-gene-0.6 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of hypothetical protein DAPPUDRAFT_213302 vs. L. salmonis genes Match: EMLSAG00000000401 (supercontig:LSalAtl2s:LSalAtl2s1063:86108:87342:-1 gene:EMLSAG00000000401 transcript:EMLSAT00000000401 description:”maker-LSalAtl2s1063-snap-gene-0.46″) HSP 1 Score: 149.443 bits (376), Expect = 4.121e-44Identity = 91/196 (46.43%), Postives = 119/196 (60.71%), Query Frame = 0 Query: 14 MDKITDLQVEPLT–NSRFVKPLRLRFKQDGKVKVWDLIQCHASVAVVIFNQTTQKFVFVRQFRPAVYFSALRRAQGDVEPGTQFKGDEIDPKVGITLELCAGIVD-KSKSLIEIAHEEILEETGYDVPMNLIEEIQTFPVGVGVGGENMTLFCAEVTEAMRKGPGGGLAEEGEMIDVIEMGVEETRTLMRAKSVT 206 MDK+ VEPL +SRFV P R+ ++Q+G…

Continue Reading hypothetical protein DAPPUDRAFT_213302, maker-scaffold2255_size18018-snap-gene-0.6 (gene) Tigriopus kingsejongensis

Biopython Contact Us | Contact Information Finder

Listing Results Biopython Contact Us Biopython · Biopython 2 hours ago Biopython.org View All Biopython. See also our News feed and Twitter. Introduction. Biopython is a set of freely available tools for biological computation written in Python by an international team of developers.. It is a distributed collaborative effort to…

Continue Reading Biopython Contact Us | Contact Information Finder

Recruitment Of Postdoctoral Scholar in Cancer Biology/Cancer Genomics University of Chicago

EMPLOYER Northwestern University LOCATION Chicago, Illinois SALARY Commensurate with experience POSTED September 21, 2021 DISCIPLINE Life Sciences, Computational Biology, Genomics, Immunology Position Type Full Time ORGANIZATION TYPE Academia Job Type Postdoc Postdoctoral recruiting (experiential or computational) is available in murine and human innate immune interactions or precision medicine approach during the development of rheumatoid…

Continue Reading Recruitment Of Postdoctoral Scholar in Cancer Biology/Cancer Genomics University of Chicago

Bioinformatics Data Wrangler Job Opening in Bethesda, MD at Computercraft

EMAIL* UPLOAD YOUR RESUME By clicking Agree, I consent to our data usage policies as stated here By agreeing to submit your resume, you consent (in accordance with our Terms of Use and Privacy Policy) to: A) Salary.com storing your resume for purposes of providing you with the job posting…

Continue Reading Bioinformatics Data Wrangler Job Opening in Bethesda, MD at Computercraft

HIV Cure Made On CRISPR Technology Gets FDA Approval For Human Trials

We could soon be very close to a cure for HIV as a CRISPR-Cas9 gene editing tech that showed success in mice is now approved for undergoing clinical trials on humans.  Reuters Also Read: No Child Will Ever Be Born Blind, If CRISPR Gene Editing Trials Work 100% In Humans The…

Continue Reading HIV Cure Made On CRISPR Technology Gets FDA Approval For Human Trials

Gromacs Contact Map | Contact Information Finder

Listing Results Gromacs Contact Map Contact maps using Gromacs ResearchGate Just Now Researchgate.net View All Contact maps using Gromacs ? I used gmx mdmat in gromacs to create contact maps, but it seems that the mdmat gives the minimum average distance rather than the average centre-of-mass distance. Estimated Reading Time:…

Continue Reading Gromacs Contact Map | Contact Information Finder

Bioinformatics Scientist in Gaithersburg, MD

We are currently searching for a Bioinformatics Scientist to provide support to the National Institutes of Health (NIH). This opportunity is a full-time position with MSC, and it is on-site in Gaithersburg, MD. Duties & Responsibilities Work independently and collaboratively to develop or optimize procedures that improve the throughput of…

Continue Reading Bioinformatics Scientist in Gaithersburg, MD

Zika Vax in the Works; STI Guidelines Updated

TTHealthWatch is a weekly podcast from Texas Tech. In it, Elizabeth Tracey, director of electronic media for Johns Hopkins Medicine, and Rick Lange, MD, president of the Texas Tech University Health Sciences Center in El Paso, look at the top medical stories of the week. This week’s topics include screening…

Continue Reading Zika Vax in the Works; STI Guidelines Updated

MD Anderson Cancer Center hiring Research Assistant I – Bioinformatics in Houston, Texas, United States

SummaryThe primary purpose of the Research Assistant I position is to provide expertise in bioinformatics and biostatistics regarding the crucial link between raw data and its use by the biologist/physician requesting the research study, while adhering to standard operating procedures. CORE VALUES Caring Behaviors Courtesy: Is respectful and courteous to…

Continue Reading MD Anderson Cancer Center hiring Research Assistant I – Bioinformatics in Houston, Texas, United States

Genome-wide analysis reveals associations between climate and regional patterns of adaptive divergence and dispersal in American pikas

Alexander DH, Novembre J, Lange K (2009) Fast model-based estimation of ancestry in unrelated individuals. Genome Res 19:1655–1664 CAS  PubMed  PubMed Central  Article  Google Scholar  Alexander DH, Shringarpure SS, Novembre J, Lange K (2015) Admixture 1.3 software manual. UCLA Hum Genet Softw Distrib, Los Angeles Google Scholar  Angert AL, Bontrager…

Continue Reading Genome-wide analysis reveals associations between climate and regional patterns of adaptive divergence and dispersal in American pikas

GenBank Biologist – Bethesda, MD

Job Description Interested in an exciting and rewarding alternative career in the biosciences? Tired of bench work? Enjoy puzzles and problem solving? Incredibly detail oriented? If you answered yes to these questions, consider joining our team of highly skilled and dedicated scientists working on site at the National Center for…

Continue Reading GenBank Biologist – Bethesda, MD

FDA clears IND application for CRISPR-edited T-cell receptor therapy to treat AML

September 17, 2021 1 min read ADD TOPIC TO EMAIL ALERTS Receive an email when new articles are posted on Please provide your email address to receive an email when new articles are posted on . “ data-action=”subscribe”> Subscribe We were unable to process…

Continue Reading FDA clears IND application for CRISPR-edited T-cell receptor therapy to treat AML

Gradle Build Error With Intellij

You can verify the problem is with Gradle scripts by running gradle help which executes configuration scripts but no Gradle tasks. If the error persists build. More examples on the classpath customization are available here. Tasks view and task execution. In the Eclipse IDE you can execute tasks from the…

Continue Reading Gradle Build Error With Intellij

GitHub – MD-Anderson-Bioinformatics/EGFR-Structure-Function-Nature-Manuscript

These files contain the source data and code used for the analyses included in the publication Robichaux et al 2021, “Structure-based classification predicts drug response in EGFR mutant NSCLC” These files will be made public at the time of acceptance.The files include but are not limited to: Summary of EGFR…

Continue Reading GitHub – MD-Anderson-Bioinformatics/EGFR-Structure-Function-Nature-Manuscript