Tag: NGS

NuProbe Technology Showcases Quantitative PCR for

Houston, January 18, 2022 (GLOBE NEWSWIRE) – NuProbe, a genomics and molecular diagnostics company that develops ultra-sensitive tests for precision cancer research, today released research demonstrating new technology to qualitatively and quantitatively detect multiple low-grade variants frequency in a quantitative PCR (qPCR reaction). The new allele-specific BDA technology (As-BDA) uses…

Continue Reading NuProbe Technology Showcases Quantitative PCR for

Senior Manager, Bioinformatics and Genomics Data Scientist

Job Description Do you want to be part of an inclusive team that works to develop innovative therapies for patients? Every day, we are driven to develop and deliver innovative and effective new medicines to patients and physicians. If you want to be part of this exciting work, you belong…

Continue Reading Senior Manager, Bioinformatics and Genomics Data Scientist

Bioconductor – RiboCrypt

DOI: 10.18129/B9.bioc.RiboCrypt     Interactive visualization in genomics Bioconductor version: Release (3.14) R Package for interactive visualization and browsing NGS data. It contains a browser for both transcript and genomic coordinate view. In addition a QC and general metaplots are included, among others differential translation plots and gene expression plots….

Continue Reading Bioconductor – RiboCrypt

Roche hiring Sr Bioinformatics Scientist in Cambridge, Massachusetts, United States

SUMMARY We are seeking a talented and motivated Senior Bioinformatics Scientist who will be an integral member of the Sequencing team contributing to the support and development of ground-breaking next-generation sequencing (NGS) products. As a member of Roche’s Sequencing and Life Science (SLS), Scientific Support and Applications team, you will…

Continue Reading Roche hiring Sr Bioinformatics Scientist in Cambridge, Massachusetts, United States

Identification of missed viruses by metagenomic sequencing of clinical respiratory samples from Kenya

The detection of viruses As shown in Table 1, viral NGS identified at least one syndrome-associated mammalian virus in 35 of 95 Kilifi County Hospital (KCH) inpatient samples (36.8%) and 23 of 95 household cohort (study investigating Who-Acquires-Infection-From-Whom, WAIFW) samples (24.2%), leading to an overall 30.5% “missed virus detection rate”….

Continue Reading Identification of missed viruses by metagenomic sequencing of clinical respiratory samples from Kenya

Comparison of CNV analysis methods: Array CGH vs NGS

Rare genetic disorders are caused by variants in major functional genes. Most are SNV or INDEL variants, but SVs, such as CNVs or chromosomal variants, can also be the cause. Recently, a large-scale study has also been published showing that CNVs were identified in 11-12% more infants and children with…

Continue Reading Comparison of CNV analysis methods: Array CGH vs NGS

Exact Sciences hiring Director, Bioinformatics in San Diego Metropolitan Area

Summary Of Major ResponsibilitiesThe Director, Bioinformatics is self-driven, working on multiple projects that are extremely complex in scope. As a thought leader, the Director, Bioinformatics brings their knowledge and expertise to bear in planning, design, and execution to ensure successful and timely completion of large or complex projects. The Director,…

Continue Reading Exact Sciences hiring Director, Bioinformatics in San Diego Metropolitan Area

Associate Director, Bioinformatics Job Opening in Wilmington, DE at Incyte Corporation

Incyte is a biopharmaceutical company focused on the discovery, development, and commercialization of novel medicines to meet serious unmet medical needs in oncology and inflammation and autoimmunity. Incyte is committed to the rigorous pursuit of research and development excellence to improve the lives of patients, make a difference in health…

Continue Reading Associate Director, Bioinformatics Job Opening in Wilmington, DE at Incyte Corporation

Addgene: pEJS1096 Dual-sgRNA.Design 1 Sequences

> Addgene NGS Result CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCGTCGGGCGACCTTTGGTCGCCCGG CCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATCACTAGGGGTTCCTGCGGCCTCTA GAGTTTAAACAAAAAAATAAACGATGCCCCTTAAAGCAGAAGCTTTAAGGGGCAGAGCGTTGCGGCACAT CTTTTCAGACGGCCTTATTGTAGCAACGTTTCGGGAGCTACAACTGAAGAGCTGGAATGCTCTTCCGGTG TTTCGTCCTTTCCACAAGATATATAAAGCCAAGAAATCGAAATACTTTCAAGTTACGGTAAGCATATGAT AGTCCATTTTAAAACATAATTTTAAAACTGCAAACTACCCAAGAAATTATTACTTTCTACGTCACGTATT TTGTACTAATATCTTTGTGTTTACAGTCAAATTAATTCTAATTATCTCTCTAACAGCCTTGTATCGTATA TGCAAATATGAAGGAATCATGGGAAATAGGCCCTCTTCCTGCCCGACCTTGACGGGTAGTGTTTAAACAA AAAAATAAACGATGCCCCTTAAAGCAGAAGCTTTAAGGGGCAGAGCGTTGCGGCACATCTTTTCAGACGG CCTTATTGTAGCAACGTTTCGGGAGCTACAACTGAGACGTGGAATCGTCTCCGGTGTTTCGTCCTTTCCA CAAGATATATAAAGCCAAGAAATCGAAATACTTTCAAGTTACGGTAAGCATATGATAGTCCATTTTAAAA CATAATTTTAAAACTGCAAACTACCCAAGAAATTATTACTTTCTACGTCACGTATTTTGTACTAATATCT TTGTGTTTACAGTCAAATTAATTCTAATTATCTCTCTAACAGCCTTGTATCGTATATGCAAATATGAAGG AATCATGGGAAATAGGCCCTCATTATCCTCTAGAATGGAGGCGGTACTATGTAGATGAGAATTCAGGAGC AAACTGGGAAAAGCAACTGCTTCCAAATATTTGTGATTTTTACAGTGTAGTTTTGGAAAAACTCTTAGCC TACCAATTCTTCTAAGTGTTTTAAAATGTGGGAGCCAGTACACATGAAGTTATAGAGTGTTTTAATGAGG CTTAAATATTTACCGTAACTATGAAATGCTACGCATATCATGCTGTTCAGGCTCCGTGGCCACGCAACTC ATACTTAAGCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGAACACCGCCACCATGGT GCCTAAGAAGAAGAGAAAGGTGGAAGATATGGCCGCCTTCAAGCCTAACCCAATCAATTACATCCTGGGA CTGGACATCGGAATCGCATCCGTGGGATGGGCTATGGTGGAGATCGACGAGGAGGAGAATCCTATCCGGC TGATCGATCTGGGCGTGAGAGTGTTTGAGAGGGCCGAGGTGCCAAAGACCGGCGATTCTCTGGCTATGGC CCGGAGACTGGCACGGAGCGTGAGGCGCCTGACACGGAGAAGGGCACACAGGCTGCTGAGGGCACGCCGG CTGCTGAAGAGAGAGGGCGTGCTGCAGGCAGCAGACTTCGATGAGAATGGCCTGATCAAGAGCCTGCCAA ACACCCCCTGGCAGCTGAGAGCAGCCGCCCTGGACAGGAAGCTGACACCACTGGAGTGGTCTGCCGTGCT GCTGCACCTGATCAAGCACCGCGGCTACCTGAGCCAGCGGAAGAACGAGGGAGAGACAGCAGACAAGGAG CTGGGCGCCCTGCTGAAGGGAGTGGCCAACAATGCCCACGCCCTGCAGACCGGCGATTTCAGGACACCTG CCGAGCTGGCCCTGAATAAGTTTGAGAAGGAGTCCGGCCACATCAGAAACCAGAGGGGCGACTATAGCCA CACCTTCTCCCGCAAGGATCTGCAGGCCGAGCTGATCCTGCTGTTCGAGAAGCAGAAGGAGTTTGGCAAT CCACACGTGAGCGGAGGCCTGAAGGAGGGAATCGAGACCCTGCTGATGACACAGAGGCCTGCCCTGTCCG GCGACGCAGTGCAGAAGATGCTGGGACACTGCACCTTCGAGCCTGCAGAGCCAAAGGCCGCCAAGAACAC CTACACAGCCGAGCGGTTTATCTGGCTGACAAAGCTGAACAATCTGAGAATCCTGGAGCAGGGATCCGAG AGGCCACTGACCGACACAGAGAGGGCCACCCTGATGGATGAGCCTTACCGGAAGTCTAAGCTGACATATG CCCAGGCCAGAAAGCTGCTGGGCCTGGAGGACACCGCCTTCTTTAAGGGCCTGAGATACGGCAAGGATAA TGCCGAGGCCTCCACACTGATGGAGATGAAGGCCTATCACGCCATCTCTCGCGCCCTGGAGAAGGAGGGC CTGAAGGACAAGAAGTCCCCCCTGAACCTGAGCTCCGAGCTGCAGGATGAGATCGGCACCGCCTTCTCTC TGTTTAAGACCGACGAGGATATCACAGGCCGCCTGAAGGACAGGGTGCAGCCTGAGATCCTGGAGGCCCT GCTGAAGCACATCTCTTTCGATAAGTTTGTGCAGATCAGCCTGAAGGCCCTGAGAAGGATCGTGCCACTG ATGGAGCAGGGCAAGCGGTACGACGAGGCCTGCGCCGAGATCTACGGCGATCACTATGGCAAGAAGAACA CAGAGGAGAAGATCTATCTGCCCCCTATCCCTGCCGACGAGATCAGAAATCCTGTGGTGCTGAGGGCCCT GTCCCAGGCAAGAAAAGTGATCAACGGAGTGGTGCGCCGGTACGGATCTCCAGCCCGGATCCACATCGAG ACCGCCAGAGAAGTGGGCAAGAGCTTCAAGGACCGGAAGGAGATCGAGAAGAGACAGGAGGAGAATCGCA AGGATCGGGAGAAGGCCGCCGCCAAGTTTAGGGAGTACTTCCCTAACTTTGTGGGCGAGCCAAAGTCTAA GGACATCCTGAAGCTGCGCCTGTACGAGCAGCAGCACGGCAAGTGTCTGTATAGCGGCAAGGAGATCAAT CTGGTGCGGCTGAACGAGAAGGGCTATGTGGAGATCGATCACGCCCTGCCTTTCTCCAGAACCTGGGACG ATTCTTTTAACAATAAGGTGCTGGTGCTGGGCAGCGAGAACCAGAATAAGGGCAATCAGACACCATACGA GTATTTCAATGGCAAGGACAACTCCAGGGAGTGGCAGGAGTTCAAGGCCCGCGTGGAGACCTCTAGATTT…

Continue Reading Addgene: pEJS1096 Dual-sgRNA.Design 1 Sequences

Single cell RNAseq data analysis

Github repository  02-04 February 2022  SciLifeLab Solna, Tomtebodavägen 23b, Stockholm, Sweden This workshop will introduce the best practice bioinformatics methods for processing and analyses of single cell RNA-seq data via a series of online lectures and computer practicals. The total course duration is 45 hours, including the online lectures (15 hours)…

Continue Reading Single cell RNAseq data analysis

Sr. Manager of Manufacturing – Resumetojobs.com

NuProbe USA is seeking an experienced Sr. Manager, In-Vitro Diagnostics Operations who will be responsible for all aspects of manufacturing, including design transfer of newly developed products from research & development. The successful candidate will control production planning, scheduling and forecasting. The candidate will lead continuous improvements in manufacturing as…

Continue Reading Sr. Manager of Manufacturing – Resumetojobs.com

What is SNP array testing?

What is SNP array testing? The SNP array test looks for changes in specific areas of a person’s chromosomes, such as gains (duplications) or losses (deletions). These gains or losses result in extra or missing copies of genetic material. How does SNP array work? SNP array is a type of…

Continue Reading What is SNP array testing?

Postdoctoral Scholar – Bioinformatics/Biomedical Data Science

The University of Nevada, Reno (UNR) appreciates your interest in employment at our growing institution. We want your application process to go smoothly and quickly. Final applications must be submitted prior to the close of the recruitment. If you need assistance or have questions regarding the application process, please contact…

Continue Reading Postdoctoral Scholar – Bioinformatics/Biomedical Data Science

Postdoc Position in Bioinformatics in Stem Cell Neurobiology

DepartmentDepartment of Histology and Embryology  – Faculty of MedicineDeadline 28 Feb 2022Start date Jully 2022Job type full-timeJob field Science and research Medical Faculty of Masaryk University, Brno, Czech Republic, invites excellent scientists to apply for Postdoc position in Bioinformatics in Stem Cell Neurobiology   Description: The Department of Histology and Embryology is…

Continue Reading Postdoc Position in Bioinformatics in Stem Cell Neurobiology

New bioinformatics method to analyze viral sgRNA

Single guide ribonucleic acid (sgRNA) molecules are produced by discontinuous transcription, in which viral RNA-dependant RNA polymerase pauses early negative-sense RNA synthesis and then jumps to the other end of the genome. The specifics of this process are still not fully understood. Since sgRNAs can play an important role in…

Continue Reading New bioinformatics method to analyze viral sgRNA

Postdoc Position in Bioinformatics in Stem Cell Neurobiology job with MASARYK UNIVERSITY

Department Department of Histology and Embryology – Faculty of Medicine Deadline 28 Feb 2022 Start date Jully 2022 Job type full-time Job field Science and research Medical Faculty of Masaryk University, Brno, Czech Republic, invites excellent scientists to apply for Postdoc position in Bioinformatics in Stem Cell Neurobiology   Description: The Department of…

Continue Reading Postdoc Position in Bioinformatics in Stem Cell Neurobiology job with MASARYK UNIVERSITY

Clinical Bioinformatics Analyst (m/w/d) – Foundation Medicine GmbH – Biology & Life Sciences

Clinical Bioinformatics Analyst (m/w/d) PENZBERG, GERMANY Foundation Medicine is leading a transformation in cancer care, where each patient’s treatment is informed by a deep understanding of the molecular changes that contribute to their disease. As a molecular information company, we are focused on fundamentally changing the way in which patients…

Continue Reading Clinical Bioinformatics Analyst (m/w/d) – Foundation Medicine GmbH – Biology & Life Sciences

ddPCR allows 16S rRNA gene amplicon sequencing of very small DNA amounts from low-biomass samples | BMC Microbiology

1. Lane DJ, Pace B, Olsen GJ, Stahl DA, Sogin ML, Pace NR. Rapid determination of 16S ribosomal RNA sequences for phylogenetic analyses. Proc Natl Acad Sci U S A. 1985;82(20):6955–9. PubMed  PubMed Central  CAS  Google Scholar  2. Vos M, Quince C, Pijl AS, de Hollander M, Kowalchuk GA. A…

Continue Reading ddPCR allows 16S rRNA gene amplicon sequencing of very small DNA amounts from low-biomass samples | BMC Microbiology

Bioinformatics Core Facility staff position at IMB in Mainz, Germany

www.imb.de/jobs/jobdetail/bioinformatician Bioinformatician (m/f/d) (#CFBIO17) IMB (www.imb.de) is a research centre on the campus of Mainz University, Germany. It is generously funded by the Boehringer Ingelheim Foundation and the state of Rhineland-Palatinate. Our research focuses on the biology of the cell nucleus and ranges from the molecular level to organismic, systems…

Continue Reading Bioinformatics Core Facility staff position at IMB in Mainz, Germany

Average Read length

Average Read length 3 Hello Everyone! Is there a standard tool commonly used to calculate the average read length of fastq files? If yes please mention it here because I want to know the size of average reads of my fastq files so that I can decide the cutoff for…

Continue Reading Average Read length

Benchmarking the NVIDIA Clara Parabricks germline pipeline on AWS

This blog post was contributed by Ankit Sethia, PhD, and Timothy Harkins, PhD, at NVIDIA Parabricks, and Olivia Choudhury, PhD,  Sujaya Srinivasan, and Aniket Deshpande at AWS. This blog provides an overview of NVIDIA’s Clara Parabricks along with a guide on how to use Parabricks within the AWS Marketplace. It…

Continue Reading Benchmarking the NVIDIA Clara Parabricks germline pipeline on AWS

Postdoctoral Position in Structural Bioinformatics job with National Institute of Allergy and Infectious Diseases (NIAID)

  Postdoctoral Position in Structural Bioinformatics Department of Health and Human Services National Institutes of Health National Institute of Allergy and Infectious Diseases The Structural Bioinformatics Core Section (SBIS) at the National Institute of Allergy and Infectious Diseases (NIAID), Vaccine Research Center (VRC), located on the main National Institutes of…

Continue Reading Postdoctoral Position in Structural Bioinformatics job with National Institute of Allergy and Infectious Diseases (NIAID)

ncRNA | Free Full-Text | Common Features in lncRNA Annotation and Classification: A Survey

CONC 2006 SVM Eukaryotes (both protein-coding and non-coding genes) peptide length, amino acid composition, predicted secondary structure content, mean hydrophobicity, percentage of residues exposed to solvent, sequence compositional entropy, number of homologues, alignment entropy 10-fold CV on protein-coding: F1-score: 97.4% ☼ Precision: 97.1% ☼ Recall: 97.8% ◙ On non-coding: F1-score:…

Continue Reading ncRNA | Free Full-Text | Common Features in lncRNA Annotation and Classification: A Survey

BioSpace hiring Senior Bioinformatics Scientist, Primary Analysis in California, United States

Please be aware that, as a condition of employment, proof of COVID vaccination is required for all U.S.-based employees (subject to limited exceptions).Title: Bioinformatics Scientist Location: San Diego, CA, or Menlo Park, CA , or Remote Position Summary An emerging leader in next-generation sequencing technology is seeking a driven Bioinformatics…

Continue Reading BioSpace hiring Senior Bioinformatics Scientist, Primary Analysis in California, United States

Roche launches AVENIO Edge System to simplify and automate next-generation sequencing sample preparation, reduce human error and advance precision medicine

Next-generation sequencing (NGS) can better understand the genetic mechanisms associated with specific diseases and help promote personalise health care Preparing DNA for sequencing library is complicated and prone to human error, which can interfere with accurate sequencing results The new AVENIO Edge system is a fully automated solution for sample…

Continue Reading Roche launches AVENIO Edge System to simplify and automate next-generation sequencing sample preparation, reduce human error and advance precision medicine

Roche launches the AVENIO Edge System to simplify and

Next-generation sequencing (NGS) enables a better understanding of genetic mechanisms linked to specific diseases and is helping drive personalised healthcare Preparing DNA for sequencing libraries is complex and prone to human error, which can interfere with accurate sequencing results The new AVENIO Edge System is a fully-automated solution for the…

Continue Reading Roche launches the AVENIO Edge System to simplify and

Experimental and Meta-Analytic Validation of RNA Sequencing Signatures for Predicting Status of Microsatellite Instability

doi: 10.3389/fmolb.2021.737821. eCollection 2021. Affiliations Expand Affiliations 1 Laboratory For Clinical and Genomic Bioinformatics, I.M. Sechenov First Moscow State Medical University, Moscow, Russia. 2 Moscow Institute of Physics and Technology, Dolgoprudny, Russia. 3 OmicsWay Corp., Walnut, CA, United States. 4 Faculty of Biology, Lomonosov Moscow State University, Moscow, Russia. 5…

Continue Reading Experimental and Meta-Analytic Validation of RNA Sequencing Signatures for Predicting Status of Microsatellite Instability

Total sequences – FASTQC report

Total sequences – FASTQC report 1 Hello! Can someone please dummy-explain to me what exactly are total sequences? I am practicing some bioinformatic problems and in my FASTQC report I get this: Total Sequences 85988702, Sequence length 76. Does that mean that I have one target region of interest with…

Continue Reading Total sequences – FASTQC report

PacBio hiring Senior Bioinformatics Scientist, Primary Analysis in San Diego, California, United States

Please be aware that, as a condition of employment, proof of COVID vaccination is required for all U.S.-based employees (subject to limited exceptions).Title: Bioinformatics Scientist Location: San Diego, CA, or Menlo Park, CA , or Remote Position Summary An emerging leader in next-generation sequencing technology is seeking a driven Bioinformatics…

Continue Reading PacBio hiring Senior Bioinformatics Scientist, Primary Analysis in San Diego, California, United States

Bioinformatics Software Developer | IT Job Board

Opportunity to join the computational team of a exciting biotech. Your new company I am currently working alongside an Oxford based biotech that focuses on clinical research and diagnostic solutions. Founded by a team from the University of Oxford, they have aims to progress the future of genetic-based medicine and…

Continue Reading Bioinformatics Software Developer | IT Job Board

What is the procedure for the assembly of bacteriophage genomes?

What is the procedure for the assembly of bacteriophage genomes? 0 Hello, is the assembly of bacteriophages’ genome different from that of humans? I understand that it is common to use NGS to sequence the genomes of newly isolated bacteriophages, but what is the correct procedure? When isolating a new…

Continue Reading What is the procedure for the assembly of bacteriophage genomes?

QIAseq cfDNA Library Kit, 96 reactions

QIAseq cfDNA Library Kit, 96 reactions   For 96 reactions on Illumina® sequencers: enzymes and buffers for cfDNA library prep, Illumina Adapter Plate 96-plex, Illumina Library Amplification Primer and PCR Master Mix   Features • Optimal conversion of cfDNA at every step from plasma to NGS library through highly efficient…

Continue Reading QIAseq cfDNA Library Kit, 96 reactions

Sr Scientist – IVD Development – Houston

NuProbe USA Inc . is looking for a Staff/Senior Scientist to lead the IVD project development program at NuProbe to support both research and in vitro diagnostic (IVD) assays for use in medical research, clinical trials, regulatory submissions, and clinical diagnostic use.  NuProbe USA is a rapidly growing company and…

Continue Reading Sr Scientist – IVD Development – Houston

Senior Specialist, Bioinformatics Programmer job in United Arab Emirates,

United Arab Emirates United Arab Emirates University Full time Job Description Lead metagenomic and statistical analyses of data sets derived from Next Generation Sequencing (NGS) data. . Initiation/implementation, troubleshooting, and maintenance of analysis software. . Tracking project data and reporting analysis results. . Collaboration with the software engineering groups to…

Continue Reading Senior Specialist, Bioinformatics Programmer job in United Arab Emirates,

bioinformatics vacancy

On the one hand, I really liked the diversity of the bioinformatics program, and, with a degree in bioinformatics, there are many possible career paths. Updated on 2 December 2021. Exact wages will depend on experience and the industry an individual works in. Working experience with structural antigen analyses and…

Continue Reading bioinformatics vacancy

Customer Account Manager in San Diego, California

Why Us Illumina are the global leaders in the development and application of Next Generation DNA Sequencing technology, with 90% of the world’s NGS DNA sequencing data created on Illumina’s platforms. Illumina Laboratory Services (ILS) is an exciting and expanding initiative that is applying Illumina’s core sequencing technology to large…

Continue Reading Customer Account Manager in San Diego, California

Metagenomics for epidemiological surveillance in ONE HEALTH

Next-Generation Sequencing (NGS) technology has led to a new era of studying microorganisms. Using this tool, our knowledge and understanding of microbiology has expanded at a rapid pace compared to traditional methods that rely on cell culture, microscopy, serology, and polymerase chain reaction (PCR). At the community level, microorganisms…

Continue Reading Metagenomics for epidemiological surveillance in ONE HEALTH

Genome Bioinformatics Analyst – Pittsburgh

**Description** UPMC Presbyterian is hiring a Genome Bioinformatics Analyst to join the Molecular and Genomic Pathology Laboratory (MGP) team! This role will work a daylight schedule Monday through Friday. No weekends or holidays are required! The Molecular and Genomic Pathology Laboratory (MGP) is a dynamic state-of-the-art clinical laboratory that prides…

Continue Reading Genome Bioinformatics Analyst – Pittsburgh

How to call LOH with FreeC

How to call LOH with FreeC 0 Good morning, I am try to infer loss of heterozygosity (LOH) from WGS data using Freec. For this purpose, I am using these parameters in the “[BAF]” section of the configuration file: [BAF] makePileup = My_somaticVCF.vcf.gz fastaFile = hg19.fa SNPfile = hg19_snp142.SingleDiNucl.1based.txt.gz When…

Continue Reading How to call LOH with FreeC

Eurofins BioDiagnostics adds BDI Prime Seq to Accelerate Corn Breeding Efforts

Eurofins BioDiagnostics, Inc. (EBDI) announces the validation of BDI Prime Seq as a sequencing based method for testing of maize breeding populations from its River Falls, Wisconsin, location. The new testing service uses an amplicon based DNA sequencing approach to screen through thousands of corn plants from breeding populations. This…

Continue Reading Eurofins BioDiagnostics adds BDI Prime Seq to Accelerate Corn Breeding Efforts

Job Application for Principal Scientist, Bioinformatics at GentiBio

About GentiBio GentiBio is an emerging biotherapeutics company co-founded by pioneers in Treg biology and synthetic immunology from Seattle Children’s Research Institute, Benaroya Research Institute, and MIGAL Galilee Research Institute. GentiBio is focused on the development of EngTregs programmed to treat autoimmune, alloimmune, autoinflammatory and allergic diseases. GentiBio’s proprietary autologous…

Continue Reading Job Application for Principal Scientist, Bioinformatics at GentiBio

Qiagen (QGEN) Collaborates with Denovo to Develop Companion Diagnostic Test for the Treatment of Diffuse Large B-Cell Lymphoma (DLBCL

News and research before you hear about it on CNBC and others. Claim your 1-week free trial to StreetInsider Premium here. QIAGEN (NYSE: QGEN) and Denovo Biopharma LLC today announced a collaboration to develop a blood-based companion diagnostic (CDx) test to identify patients expressing Denovo Genomic Marker 1 (DGM1TM) who…

Continue Reading Qiagen (QGEN) Collaborates with Denovo to Develop Companion Diagnostic Test for the Treatment of Diffuse Large B-Cell Lymphoma (DLBCL

Director of Bioinformatics Research Job Opening in Hudson, FL at M2GEN

Director of Bioinformatics Research Location:  Remote Status:  Full-time ExemptReports to:  VP Bioinformatics & BiostatisticsDirect Reports:  Build and lead a team consisting of bioinformatics research scientists that support internal business development client engagements, as well as, external academic partner research projects and biopharma sponsored bioinformatics services Who we are M2GEN is…

Continue Reading Director of Bioinformatics Research Job Opening in Hudson, FL at M2GEN

Reliability of Cell-Free DNA (cfDNA) Next Generation Sequencing in Predicting Chromosomal Structural Abnormalities and Cytogenetic-Risk Stratification of Patients with Myeloid Neoplasms

Oral and Poster Abstracts 617. Acute Myeloid Leukemias: Biomarkers, Molecular Markers and Minimal Residual Disease in Diagnosis and Prognosis: Poster III Translational Research Maher Albitar, MD1*, Andrew Ip, MD, MSc2, Andre H. Goy, MD3*, Jeffrey Justin Estella, BS, MS1*, Ivan De Dios, BS1*,…

Continue Reading Reliability of Cell-Free DNA (cfDNA) Next Generation Sequencing in Predicting Chromosomal Structural Abnormalities and Cytogenetic-Risk Stratification of Patients with Myeloid Neoplasms

Best practice to pool samples for sequencing?

Best practice to pool samples for sequencing? 0 Hello, it’s my first time having a library sequenced. I have 96 samples with varying concentrations. We are supposed to deliver a 4nm pool to the sequencing facility. My question is; what is the best way to pool all the samples? Does…

Continue Reading Best practice to pool samples for sequencing?

QIAGEN and Denovo Biopharma Partner to Develop Companion Diagnostic Test for the Treatment of Diffuse Large B-Cell Lymphoma (DLBCL)

QIAGEN’s blood-based test will help to identify patients with Diffuse Large B-Cell Lymphoma (DLBCL) likely to respond to Denovo’s new investigational cancer treatment DB102TM The partners seek FDA premarket approval (PMA) of the companion diagnostic test in tandem with the new drug application (NDA) approval. New master collaboration agreement adds…

Continue Reading QIAGEN and Denovo Biopharma Partner to Develop Companion Diagnostic Test for the Treatment of Diffuse Large B-Cell Lymphoma (DLBCL)

Next Generation Sequencing Industry to Cross $34.8 Billion by 2027

DUBLIN, Dec. 8, 2021 /PRNewswire/ — The “Next Generation Sequencing Market, Global Forecast, Impact of COVID-19, Industry Trends, Growth, Opportunity By Types of Test, Company Analysis” report has been added to ResearchAndMarkets.com‘s offering. According to the report, the Global Next Generation Sequencing Market will reach US$ 34.8 Billion by 2027….

Continue Reading Next Generation Sequencing Industry to Cross $34.8 Billion by 2027

Proven Recruiting hiring Bioinformatics Scientist in San Diego, California, United States

If culture and mentorship are your priorities – you’ve found your match. This pioneer company in Biotech is looking to support and promote a talented Bioinformatics Scientist who will assist in advancing the promise of genomics using data mining and integration of data. The ideal professional will have a strong…

Continue Reading Proven Recruiting hiring Bioinformatics Scientist in San Diego, California, United States

Quantum-Si hiring Senior/Staff Bioinformatics Scientist in San Diego, California, United States

Company DescriptionQuantum-Si is pioneering a new generation of technology to create the market of Next Generation Protein Sequencing (NGPS). Similar to Next Generation DNA Sequencing (NGS), which gave us a blueprint of what could happen by studying our DNA, NGPS enables an unbiased view of the proteome through improved scale,…

Continue Reading Quantum-Si hiring Senior/Staff Bioinformatics Scientist in San Diego, California, United States

the spacer of sgrna will hybridize with this sequence of dna from the fragment shown below?

James Guys, does anyone know the answer? get the spacer of sgrna will hybridize with this sequence of dna from the fragment shown below? from EN Bilgi. Solved The spacer of sgRNA will hybridize with this sequence Answer to Solved The spacer of sgRNA will hybridize with this sequence Do…

Continue Reading the spacer of sgrna will hybridize with this sequence of dna from the fragment shown below?

Postdoctoral Research Scientist, Bioinformatics – Turajlic lab job with The Francis Crick Institute

Reports to: Samra Turajlic [C] Job Description: Project summary An exciting opportunity to be part of a pioneering biomedical research institute, dedicated to innovation and science, in the laboratory of Samra Turajlic (Cancer Dynamics, www.crick.ac.uk/research/labs/samra-turajlic). We are seeking a highly collaborative and self-motivated post-doctoral bioinformatician to work within our comprehensive…

Continue Reading Postdoctoral Research Scientist, Bioinformatics – Turajlic lab job with The Francis Crick Institute

query sequence is input sequence or its reverse complement

query sequence is input sequence or its reverse complement 0 >sp|O14920.1|IKKB_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase subunit beta; Short=I-kappa-B-kinase beta; Short=IKK-B; Short=IKK-beta; Short=IkBKB; AltName: Full=I-kappa-B kinase 2; Short=IKK2; AltName: Full=Nuclear factor NF-kappa-B inhibitor kinase beta; Short=NFKBIKB; AltName: Full=Serine/threonine protein kinase IKBKB MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT LAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLM LMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED QELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSI…

Continue Reading query sequence is input sequence or its reverse complement

Sr. Research Scientist I, Bioinformatics job with Gilead Sciences, Inc.

Sr. Research Scientist I, BioinformaticsUnited States – California – Foster City Gilead Sciences, Inc. is a research-based bio-pharmaceutical company that discovers, develops and commercializes innovative medicines in areas of unmet medical need. With each new discovery and investigational drug candidate, we seek to improve the care of patients living with…

Continue Reading Sr. Research Scientist I, Bioinformatics job with Gilead Sciences, Inc.

‘Deprecated’ Error with ngs.plot.r after sys admin update Bioconductor

Loading R libraries…..Done Configuring variables… Using database: /home/yensin/software/ngsplot/database/hg19/hg19.ensembl.genebody.protein_coding.RData Done Analyze bam files and calculate coverageWarning message: ‘isNotPrimaryRead’ is deprecated. Use ‘isSecondaryAlignment’ instead. See help(“Deprecated”) ………………………………………………………………………………………………………………………………………………………………………………….Done Plotting figures…Error in seq.default(min.e, max.e, length.out = ncolor + 1) : ‘from’ cannot be NA, NaN or infinite Calls: plotheat -> ColorBreaks -> seq ->…

Continue Reading ‘Deprecated’ Error with ngs.plot.r after sys admin update Bioconductor

Roche hiring Principal Bioinformatics Scientist in Pleasanton, California, United States

Impact Healthcare Roche is dedicated to advancing personalized healthcare by creating diagnostics and treatments tailored to individual genetic and disease profiles. As part of this mission, Roche Sequencing Solutions is unifying next-generation sequencing with the goal of making it routine sample in – result out. Make a Big Difference Cancer…

Continue Reading Roche hiring Principal Bioinformatics Scientist in Pleasanton, California, United States

Data Demonstrates Lucence Liquid Biopsy Test Can Track Treatment-Based ctDNA Changes

NEW YORK – At the European Society for Medical Oncology Congress this week, precision oncology assay developer Lucence presented data that demonstrated its amplicon-based LiquidHallmark assay could be used to personalize care for people with advanced urothelial carcinoma. LiquidHallmark is a laboratory-developed test based on the company’s AmpliMark next-generation sequencing platform…

Continue Reading Data Demonstrates Lucence Liquid Biopsy Test Can Track Treatment-Based ctDNA Changes

Biopython Contact Us | Contact Information Finder

Listing Results Biopython Contact Us Biopython · Biopython 2 hours ago Biopython.org View All Biopython. See also our News feed and Twitter. Introduction. Biopython is a set of freely available tools for biological computation written in Python by an international team of developers.. It is a distributed collaborative effort to…

Continue Reading Biopython Contact Us | Contact Information Finder

Amgen Is Recruiting A Principal Scientist

Employer Amgen Location South San Francisco, CA Posted Sep 20, 2021 Ref R-121973 Discipline Science/R&D, Biology, Biotechnology Hotbed  Biotech Bay, Ideal Employer Required Education Bachelors Degree Position Type Full time Amgen is a leading global biotechnology company, with a mission to serve patients around the world. The Clinical Biomarkers &…

Continue Reading Amgen Is Recruiting A Principal Scientist

Affinia Therapeutics hiring Senior Scientist, Bioinformatics/Computational Biology in Waltham, MA, US

About Affinia Therapeutics Affinia Therapeutics is working to transform gene therapy through a methodically designed proprietary platform. By engineering vectors and gene constructs, Affinia is building toward revolutionary treatments for devastating diseases. Job Description Scientist/Senior Scientist, Bioinformatics/Computational Biology Affinia Therapeutics is an innovative gene therapy company with a proprietary platform…

Continue Reading Affinia Therapeutics hiring Senior Scientist, Bioinformatics/Computational Biology in Waltham, MA, US

How to transform a whole-genome callset into whole-exome callset?

How to transform a whole-genome callset into whole-exome callset? 0 Hi all, I have a callset from whole-genome data and with this callset, I want to transform it into exome callset by extracting the variants using a exome target interval. I obtained two exome target list, one from 1KG project…

Continue Reading How to transform a whole-genome callset into whole-exome callset?

Korea to establish national digital library on health and genome data by 2028

Global next-generation sequencing and technology expert Illumina will assist multi-ministerial project National Project of Bio Big Data in Korea has selected Illumina technology for the second pilot project in their effort to work towards establishing a national digital library on health and genome data by 2028. The multi-ministerial project is…

Continue Reading Korea to establish national digital library on health and genome data by 2028

Persistent Systems hiring #2 Bioinformatics QA – South SFO, CA in Santa Clara, California, United States

About PersistentWe are a trusted Digital Engineering and Enterprise Modernization partner, combining deep technical expertise and industry experience to help our clients anticipate what’s next. Our offerings and proven solutions create unique competitive advantage for our clients by giving them the power to see beyond and rise above. We are…

Continue Reading Persistent Systems hiring #2 Bioinformatics QA – South SFO, CA in Santa Clara, California, United States

Zymo Research Corp hiring Junior Bioinformatics Associate in Tustin, California, United States

Summary/Contribution Of PositionZymo Research is seeking a Junior Bioinformatics Associate to join our Bioinformatics team. The qualified individual will play a key role in establishing, maintaining, and executing data-analysis pipelines for Next-Generation Sequencing methods to support Zymo Research’s global product strategy. This role will work cross functionally with R&D, product…

Continue Reading Zymo Research Corp hiring Junior Bioinformatics Associate in Tustin, California, United States

Harnham hiring BIOINFORMATICS ENGINEER in San Francisco, California, United States

BIOINFORMATICS ENGINEERSAN FRANCISCO BAY AREA$140,000 – $170,000 + BENEFITS The CompanyThis microbiome start-up is looking for a bioinformatics engineer to drive development of existing and novel tools. Using Python, DNA sequencing and AWS, this bioinformatics engineer will spearhead the tooling development and bioinformatics analysis. Join their team to create a…

Continue Reading Harnham hiring BIOINFORMATICS ENGINEER in San Francisco, California, United States

Guardant Health Manager, Bioinformatics – Tissue Oncology (Redwood City, CA, San Diego, CA Or Seattle WA optional)

* PhD in bioinformatics, computational biology, cancer genomics or related fields * 4+ years of relevant industry experience * Expertise in next-generation sequencing data generation, processing, and analysis, including experience in developing novel statistical methods and machine learning applications *  Experience in analyzing public epigenomic datasets such as TCGA, Epigenomic…

Continue Reading Guardant Health Manager, Bioinformatics – Tissue Oncology (Redwood City, CA, San Diego, CA Or Seattle WA optional)

Illumina hiring Bioinformatics Software Engineer 2 in San Diego, California, United States

Illumina’s Customer Collaboration & Innovation (CCI) team transforms the relationship between top-tier customers and our Product Development organization, and we are looking for a select individual to join the team as a Bioinformatics Software Engineer 2. The team works externally with a small number of Illumina’s top customers to design…

Continue Reading Illumina hiring Bioinformatics Software Engineer 2 in San Diego, California, United States

New PacBio Library Prep Method Helps Cover ‘Death Valley’ Between Short and Long Reads

ST. PAUL, MINNESOTA – Researchers from the University of Minnesota have developed a library preparation method for Pacific Bioscience’s Sequel platform that addresses the challenge of sequencing DNA molecules that are too long for short reads but not long enough to make long-read sequencing cost effective. Their solution: link up…

Continue Reading New PacBio Library Prep Method Helps Cover ‘Death Valley’ Between Short and Long Reads

POSTDOCTORAL FELLOW IN TRANSCRIPTOMICS AND BIOINFORMATICS

We are looking for an enthusiastic and ambitious postdoctoral fellow to study the pathophysiological bases of vascular anomalies via an integrated analysis of “omics” data (incl. single cell and bulk transcriptome, methylome, genome). The postdoctoral fellow will participate in all the omic aspects of the studies, from data analysis and…

Continue Reading POSTDOCTORAL FELLOW IN TRANSCRIPTOMICS AND BIOINFORMATICS

Associate Director, Computational Biology/Bioinformatics Job Opening in Cambridge, MA at Obsidian Therapeutics

About Us… Obsidian Therapeutics is pioneering engineered cell and gene therapies to deliver transformative outcomes for patients. Obsidian’s programs apply our CytoDriveTM technology in Cell and Gene therapy products to control expression of proteins for enhanced therapeutic efficacy and safety. We’re proud of our diverse talented team and committed to…

Continue Reading Associate Director, Computational Biology/Bioinformatics Job Opening in Cambridge, MA at Obsidian Therapeutics

Bioinformatics Engineer job with Paramount Recruitment

Bioinformatics Engineer – London Paramount is working closely with a client who is now moving towards a future of enabling faster, deeper genomic research, bringing genomic healthcare to all who need it. They are now urgently looking for a Bioinformatics Engineer to join their team in London. As a Bioinformatics…

Continue Reading Bioinformatics Engineer job with Paramount Recruitment

Bioinformatics Software Engineer 2 in San Diego, California

Illumina’s Customer Collaboration & Innovation (CCI) team transforms the relationship between top-tier customers and our Product Development organization, and we are looking for a select individual to join the team as a Bioinformatics Software Engineer 2.  The team works externally with a small number of Illumina’s top customers to design…

Continue Reading Bioinformatics Software Engineer 2 in San Diego, California

Bioinformatics and Assay Development Scientist II – San Francisco, CA | South San Francisco, CA

Date posted: Sep 16, 2021 Bioinformatics and Assay Development Scientist II – San Francisco, CA The Monogram division of LabCorp, which is focused on high complexity cell-based assay development, has an exciting opportunity for a Scientist to join its R&D Diagnostics Development Team. The selected candidate will design, build and…

Continue Reading Bioinformatics and Assay Development Scientist II – San Francisco, CA | South San Francisco, CA

Hartmann Young hiring Associate Director Bioinformatics – A.I. Genomics in United States

Associate Director of Bioinformatics – A.I. Genomics Hartmann Young are exclusively partnered with a pioneer within precision metagenomics headhunt for an Associate Director Bioinformatics. The company are working with excitin technology that provides hands-off, AI-powered automated improved pathogen detection, genomic profiling, and quantification of tens of thousands of pathogens from…

Continue Reading Hartmann Young hiring Associate Director Bioinformatics – A.I. Genomics in United States

Bioinformatics Analyst 40%-60%, Zurich, fixed-term

Bioinformatics Analyst 40%-60%, Zurich, fixed-term 40%-60%, Zurich, fixed-term The ETH Zurich core facility NEXUS Personalized Health Technologies enables discovery and translational research for personalized health. We are recruiting a part-time Bioinformatics Analyst for the Clinical Bioinformatics Unit in Zurich to commence immediately or by mutual agreement. Job description The mission of…

Continue Reading Bioinformatics Analyst 40%-60%, Zurich, fixed-term

Senior Bioinformatics Engineer | United States

Natera™ is a global leader in cell-free DNA (cfDNA) testing with a focus on women’s health, oncology, and organ health. To bolster our oncology products, we are looking for a Senior Bioinformatics Engineer to provide technical leadership and process guidance. Through collaboration between the product and development teams, the Senior…

Continue Reading Senior Bioinformatics Engineer | United States

Bioinformatics Scientist Job Opening in Iowa City, IA at Jones Microbiology Institute Inc

Description: JMI Laboratories is a mid-sized company based in North Liberty, IA. A global leader for twenty years in anti-infectives research, JMI monitors annual changes in antibiotic resistance patterns through the SENTRY Antimicrobial Surveillance Program, serves as a clinical and reference laboratory in support of new drug development, and conducts…

Continue Reading Bioinformatics Scientist Job Opening in Iowa City, IA at Jones Microbiology Institute Inc

Bioinformatics Training Developer job with The Francis Crick Institute

Bioinformatics and Biostatistics Core Facility   Reports to: Head of Bioinformatics Core Facility   This is a full-time, permanent position on Crick Terms and Conditions of Employment.                                              …

Continue Reading Bioinformatics Training Developer job with The Francis Crick Institute

Principal Bioinformatics Scientist – Cell and Gene Therapy

Principal Bioinformatics Scientist – Cell and Gene Therapy Germany – Pharma The global Computational Biology and Digital Sciences (gCBDS) department is engaged in target discovery research and the application of innovative methods to resolve causative factors in disease progression. This is a great opportunity to lead computational projects in a…

Continue Reading Principal Bioinformatics Scientist – Cell and Gene Therapy

New publication in European Urology demonstrates value of PredicineCARE liquid biopsy test for monitoring PD-L1 immunotherapy in patients with metastatic prostate cancer | News

HAYWARD, Calif., Sept. 16, 2021 /PRNewswire-PRWeb/ — Predicine, Inc. announced today results from a liquid biopsy study demonstrating the clinical application of utilizing the PredicineCARE liquid biopsy NGS assay to serially monitor changes in ctDNA levels in patients with metastatic castration-resistant prostate cancer (mCRPC). The European Urology study evaluated the effects…

Continue Reading New publication in European Urology demonstrates value of PredicineCARE liquid biopsy test for monitoring PD-L1 immunotherapy in patients with metastatic prostate cancer | News

Minimizers – how to use them?

Minimizers – how to use them? 0 Hi All! I would like to ask you about minimizers and their usage in NGS. I read about minimizers, and know how to prepare them (homolog.us/blogs/bioinfo/2017/10/25/intro-minimizer/), but what I don’t understand is how they are actually used in kmer matching? I know that…

Continue Reading Minimizers – how to use them?

Bioinformatics part time job/internship at Multiple locations in Leasing Managers

RHT is a bootstrapped startup which is currently market testing its business model and idea. The company intends to be a tenant engagement resource for property managers. Selected intern’s day-to-day responsibilities include: 1. Support the research analysis by developing pipelines, analysis strategies, and delivering on projects2. Run statistical tests to…

Continue Reading Bioinformatics part time job/internship at Multiple locations in Leasing Managers

Principal Bioinformatics Scientist Job Opening in San Diego, CA at DermTech

About DermTech: At DermTech, we believe there’s a better way to treat your skin, and we’re using technology, innovation, and data to fundamentally change the way the world practices dermatology. We have developed technology that assesses your skin at the RNA and DNA level, so we can see signs of…

Continue Reading Principal Bioinformatics Scientist Job Opening in San Diego, CA at DermTech

Error in Demovir

Error in Demovir 0 Hi, I am new to bioinformatics and am working on viral metagenomic (virome) datasets and so would like to use Demovir for getting taxonomic annotations on my viral contigs. I almost completed it but got stuck in the last command when running demovir.R: $Rscript demovir.R Then,…

Continue Reading Error in Demovir

World’s largest science prize – worth $3m

The world’s largest science prize has been awarded to the University of Cambridge professors who developed next-generation DNA sequencing, while two others have earned prizes given to outstanding early-career researchers. Dr Shankar Balasubramanian and Dr David Klenerman, co-founders of Solexa. Picture: Nathan Pitt / University of Cambridge (47509196) Prof Shankar…

Continue Reading World’s largest science prize – worth $3m

mixing hg38 and GRCh38 during variant calling

mixing hg38 and GRCh38 during variant calling 0 Hello everyone! I’ve been working on a variant calling pipeline for WES data and used a mix of hg38 and GRCh38 reference files after reading that hg38 is just an abbreviation of GRCh38, and that they refer to the same thing. But…

Continue Reading mixing hg38 and GRCh38 during variant calling

The Current Molecular Treatment Landscape of Advanced Colorectal Cancer and Need for the COLOMATE Platform

Next-Generation Sequencing Utilizing Tumor Tissue and/or Blood The identification of actionable genomic alterations in tumors such as mCRC was once performed by Sanger DNA sequencing of tumor DNA that was extracted from fixed paraffin-embedded tumor tissue, but this has now been replaced by next-generation sequencing (NGS), which allows for larger-scale…

Continue Reading The Current Molecular Treatment Landscape of Advanced Colorectal Cancer and Need for the COLOMATE Platform

Intepreting kmer spectrum

Intepreting kmer spectrum 0 Could someone provide an intuitive description of how to inerpret a k-mer spectrum? I understand that the plot shows how many kmers appear a certain number of times, but could someone describe to me what valuable information we can gain from visualizing kmer counts this way?…

Continue Reading Intepreting kmer spectrum

CyberCoders hiring Senior Bioinformatics Scientist in Boston, Massachusetts, United States

If you are a Senior Bioinformatics Scientist with experience, please read on! We are a Gene Therapy start up focused on using a holistic approach to bring manufacturing, engineering and research all under one roof.Top Reasons to Work with Us1. We have closed 10s of millions in funding 2. We…

Continue Reading CyberCoders hiring Senior Bioinformatics Scientist in Boston, Massachusetts, United States

Dr. J. Curtis Nickel Urinary Microbiome Study Using MicroGenDX NGS Indicates Microbial Diversity Varies by Age and Gender | News

ORLANDO, Fla., Sept. 14, 2021 /PRNewswire-PRWeb/ — A study to help understand the implications of Next-Generation DNA Sequencing (NGS) in the diagnosis and treatment of Urinary Tract Infections (UTIs) and other inflammatory urological conditions has been completed, and results were presented at the September, 2021 AUA Conference. The study, a collaboration…

Continue Reading Dr. J. Curtis Nickel Urinary Microbiome Study Using MicroGenDX NGS Indicates Microbial Diversity Varies by Age and Gender | News

Personal Genome Diagnostics hiring Bioinformatics Specialist (Commercial) in Baltimore, Maryland, United States

POSITION SUMMARY:   The Bioinformatics Specialist is a customer-facing role providing technical expertise in bioinformatics and PGDx lab solutions. This position will support the sale and support of PGDx bioinformatics solutions by providing technical expertise in bioinformatics to labs and customers in support of the commercial team. This role will…

Continue Reading Personal Genome Diagnostics hiring Bioinformatics Specialist (Commercial) in Baltimore, Maryland, United States

Dr. J. Curtis Nickel Urinary Microbiome Study Using MicroGenDX NGS Indicates Microbial Diversity Varies by Age and Gender

MicroGenDX Logo The study, a collaboration between Dr. J. Curtis Nickel and MicroGen Diagnostics, identified some 643 microbial species among 211 healthy subjects (106 female and 105 male) using NGS, with significant differences in microbial diversity based on gender, age, and previous antibiotic use. ORLANDO, Fla. (PRWEB) September 14,…

Continue Reading Dr. J. Curtis Nickel Urinary Microbiome Study Using MicroGenDX NGS Indicates Microbial Diversity Varies by Age and Gender

Bioinformatician / Pipeline developer job with Paramount Recruitment

Bioinformatics / Pipeline Developer – Post DocCambridge This is a fantastic opportunity for a Post-Doc/PhD Graduate to join the R&D computational biology group as a Bioinformatics pipeline developer. This exciting company aim to transform the lives of cancer patients and their families through the development of precision treatments and ground-breaking…

Continue Reading Bioinformatician / Pipeline developer job with Paramount Recruitment

Twist Bioscience Corporation (TWST) has started shipping its synthetic RNA reference controls for the SARS-CoV-2 AY.1 and AY.2, more commonly known as Delta Plus

News and research before you hear about it on CNBC and others. Claim your 1-week free trial to StreetInsider Premium here. Twist Bioscience Corporation (Nasdaq: TWST), a company enabling customers to succeed through its offering of high-quality synthetic DNA using its silicon platform, today announced that it has started shipping…

Continue Reading Twist Bioscience Corporation (TWST) has started shipping its synthetic RNA reference controls for the SARS-CoV-2 AY.1 and AY.2, more commonly known as Delta Plus

Associate Director/Director, Bioinformatics/Computational Biology Job Opening in Cambridge, MA at ImmuneID

ImmuneID aims to revolutionize therapeutic drug development by mapping immune disease drivers through our unique, high-throughput and unbiased platforms. We are seeking an Associate Director/Director, Bioinformatics/Computational Biology to join our growing team of passionate researchers focused on unlocking human immunology. Scope As a key member of the Science team, the…

Continue Reading Associate Director/Director, Bioinformatics/Computational Biology Job Opening in Cambridge, MA at ImmuneID

Bioinformatics Manager I Job Opening in Frederick, MD at Frederick National Laboratory

Bioinformatics Manager I Job ID: req2120Employee Type: exempt full-timeFacility: Frederick: Ft DetrickLocation: PO Box B, Frederick, MD 21702 USA The Frederick National Laboratory is a Federally Funded Research and Development Center (FFRDC) sponsored by the National Cancer Institute (NCI) and operated by Leidos Biomedical Research, Inc. The lab addresses some…

Continue Reading Bioinformatics Manager I Job Opening in Frederick, MD at Frederick National Laboratory

Error in merged bam files

Error in merged bam files 0 Hello I am trying to merge unmapped and mapped bam files. I merged the bam files using the picard tool (gatk.broadinstitute.org/hc/en-us/articles/360036883871-MergeBamAlignment-Picard). I checked the merged bam using ValidateSamFile command (gatk.broadinstitute.org/hc/en-us/articles/360036854731-ValidateSamFile-Picard-) and it showed the below errors: Error Type Count ERROR:MATES_ARE_SAME_END 5496 ERROR:MISMATCH_FLAG_MATE_NEG_STRAND 5478 ERROR:MISMATCH_MATE_CIGAR_STRING…

Continue Reading Error in merged bam files

bioinformatics scientist – Besto

Bioinformatics Scientist Agexplorer Com . Learning Bioinformatics The Scientist Magazine . Bioinformatics Scientist . Bioinformatics Scientist . Learning Bioinformatics The Scientist Magazine . What Does A Bioinformatics Scientist Do . Bioinformatics Understanding Of Living Systems Through . Next Generation Bioinformatics Advaita Bioinformatics . Bioinformatics Scientist Science Engineering Career . Bioinformatics…

Continue Reading bioinformatics scientist – Besto

Senior Bioinformatics Data Scientist – Invitae

Location: San Francisco, CA or Remote in USA Invitae is dedicated to bringing comprehensive genetic information into mainstream medicine to improve healthcare for billions of people! Our team is driven to make a difference for the patients we serve. We are leading the transformation of the genetics industry by making…

Continue Reading Senior Bioinformatics Data Scientist – Invitae

UChicago Spin-Out AccuraDX Launches KAS-seq Research Kits: ‘A New Way to Study Important Biological Processes and Regulatory Pathways’

Published on Tuesday, September 14, 2021 The KAS-Direct™ ssDNA Labeling and Enrichment Kit, Version 1. (Image credit: AccuraDX) A University of Chicago spin-out company AccuraDX this week has launched its KAS-Direct™ single-stranded DNA (ssDNA) Labeling and Enrichment Kit. Founded in 2020, the company, which is headquartered in Natick, MA with an…

Continue Reading UChicago Spin-Out AccuraDX Launches KAS-seq Research Kits: ‘A New Way to Study Important Biological Processes and Regulatory Pathways’

High tumor mutation burden and DNA repair gene mutations

Introduction Anaplastic lymphoma kinase (ALK)‑fusion genes represent a small but important part of oncogenic driver mutations in NSCLC, accounting for approximately 3%‑7% of all cases worldwide.1,2 Small molecule tyrosine kinase inhibitors (TKIs) are the standard therapy for ALK-rearranged NSCLC. Crizotinib, a first-generation TKI, is the most widely used targeted drug…

Continue Reading High tumor mutation burden and DNA repair gene mutations