Categories
Tag: NPC
Metagenome analyses identify human endogenous retrovirus-K113 (HML-2) subtype in glioblastoma. Reply
. 2023 Dec 15;133(24):e176406. doi: 10.1172/JCI176406. Affiliations Expand Affiliations 1 Miller School of Medicine, Department of Neurological Surgery, University of Miami, Coral Gables, Florida, USA. 2 National Institute of Neurological Disorders and Stroke, NIH, Bethesda, Maryland, USA. Item in Clipboard Vaidya Govindarajan et al. J Clin Invest. 2023. Show details Display…
ggplot2 – Adding a box around a caption in R
One option would be to switch to ggtext::element_markdown which has a lot more options than element_text and allows to for an outline: library(ggplot2) library(ggtext) df <- as.data.frame(data(“iris”)) ggplot(data = iris, aes(x = Species, y = Petal.Width)) + geom_bar(stat = “identity”, position = “identity”) + labs(caption = “Add box around me”)…
Azafaros’ Phase 2 RAINBOW study, evaluating nizubaglustat in GM2 and NPC patients, is now fully enrolled
Azafaros’ Phase 2 RAINBOW study, evaluating nizubaglustat in GM2 and NPC patients, is now fully enrolled Azafaros’ Phase 2 RAINBOW study, evaluating nizubaglustat in GM2 and NPC patients, is now fully enrolled Topline data from the study, expected for mid-2024, will support two pivotal Phase 3 trials in GM1 and…
the condition has length > 1
absolute running error: Error in if (!is.na(res)) { : the condition has length > 1 0 the following are my R codes: install.packages(“numDeriv”) BiocManager::install(“DNAcopy”) install.packages(“ABSOLUTE_1.0.6.tar.gz”,repos = NULL) library(numDeriv) library(ABSOLUTE) RunAbsolute( seg.dat.fn = “P01_1_GISTIC_segment”, sigma.p = 0, max.sigma.h = 0.2, min.ploidy = 0.5, max.ploidy = 8, primary.disease = “NPC”, platform =…
r – ggplot colorbar align to top when using facets
I am using facetted plots via ggplot that contain a colorbar. I want to scale the colorbar to the size of the facetted plot. Following the ideas of @AllanCameron in this post regarding a single plot and tweaking the function to account for both the strip size and the space…
New study demonstrates effectiveness of toripalimab in treating nasopharyngeal carcinoma
Research led by a Chinese doctor has shown that toripalimab – a humanized monoclonal antibody against programmed death protein 1 – helps significantly improve the survival of patients with nasopharyngeal carcinoma (NPC), a type of head and neck cancer, when used in addition to chemotherapy. A report on the immunotherapy…
Coherus and Junshi Biosciences Announce Publication of
– Final overall survival analysis of the JUPITER-02 trial shows first-line treatment with LOQTORZI plus chemotherapy significantly prolongs survival in patients with recurrent or metastatic NPC irrespective of PDL-1 status– – Treatment resulted in a 37% reduction in the risk of death versus chemotherapy alone – -– LOQTORZI is the…
GMP & RUO Grade iPSC Gene Editing & Differentiation Services | Lab Equipment
Use Applied StemCell’s (ASC) new GMP facility, comprised of five cleanrooms equipped with cutting-edge technology, to develop the next generation of iPSC-derived therapeutics. We have dedicated cleanrooms for induced pluripotent stem cells (iPSC), mesenchymal stromal cells (MSC), chimeric antigen receptor T-cells (CAR-T), T-cell receptor-engineered T-cells (TCR-T), natural killer (NK) cells,…
r – Create a new custom point shape for ggplot2
I would like to use a new point shape on ggplot2, and use it the same way as geom_point(). I know that ggstar implements some new shapes, but I would like to use the following: It’s created just combining a circle with a rect, creating this new shape I think…
IJMS | Free Full-Text | CRISPR/Cas9 Directed Reprogramming of iPSC for Accelerated Motor Neuron Differentiation Leads to Dysregulation of Neuronal Fate Patterning and Function
1. Introduction As the world population ages, neurodegenerative diseases are increasing. The outcome of these diagnoses varies but can lead to fatality 50% of the time within 15–20 months [1]. Treatments for neurodegeneration, in particular motor neuron (MN) diseases, are restricted due to the limitations of motor neuron repair and…
The Power of Diagnosis and Therapy
WASHINGTON DC – In the 2023 Presidential symposium at last week’s American Society of Human Genetics (ASHG) conference, three speakers invited by the Society’s president, Brendan Lee, showcased progress that illustrated, in Lee’s words, “the power of diagnosis and the power of therapy.” “It is not a Sisyphean task,” Lee…
Pokemon Go: Best Team Against Giovanni
You’ll want to choose the best team against Giovanni you can in Pokemon Go, as he’s one of the few NPC trailers in the game that can be tough to beat. He has a team of powerful Pokemon, and is currently the most challenging opponent in the game. Fortunately, he’s…
When Glia Meet Induced Pluripotent Stem Cells (iPSCs)
Abstract The importance of glial cells, mainly astrocytes, oligodendrocytes, and microglia, in the central nervous system (CNS) has been increasingly appreciated. Recent advances have demonstrated the diversity of glial cells and their contribution to human CNS development, normal CNS functions, and disease progression. The uniqueness of human glial cells is…
r – Arrow location based on arrow size in ggplot2
I’m trying to draw an arrow with its location based on the dimensions of the arrow. Here is a reprex with the desired result: library(tidyverse) library(ggarchery) line <- structure(list(structure(c(0, 15, 35, 50, 60, 80, 100, 120, 15, 18, 25, 30, 45, 55, 57, 57, 0, 0, 0, 0, 0, 0,…
Tislelizumab vs Sorafenib as First-Line Treatment for Unresectable Hepatocellular Carcinoma: A Phase 3 Randomized Clinical Trial | Targeted and Immune Cancer Therapy | JAMA Oncology
Key Points Question How does the efficacy and safety profile of tislelizumab compare with that of sorafenib as first-line treatment among patients with unresectable hepatocellular carcinoma (HCC)? Findings In this phase 3 randomized clinical trial of 674 patients with HCC, tislelizumab demonstrated overall survival noninferiority compared with sorafenib, with numerically…
Viracta Therapeutics (VIRX) to host R&D day highlighting Nana-val in Epstein-Barr virus (EBV)-related cancers
Viracta Therapeutics, Inc. (Nasdaq: VIRX), a clinical-stage precision oncology company focused on treating and preventing virus-related cancers affecting patients worldwide, today announced plans to highlight new data from studies Preliminary clinical and preclinical data for naatinostat and valganciclovir (Nana-val), its all-oral investigational therapy for Epstein-Barr virus (EBV)-related cancers, today (Wednesday,…
DICT: Hackers leaked PhilHealth data
Hackers leaked the compromised data from a recent ransomware attack against the Philippine Health Insurance Corporation (PhilHealth), the Department of Information and Communications Technology (DICT) said Thursday. The DICT said the Medusa ransomware group uploaded a copy of over 600 gigabytes of files to a website and a Telegram channel…
r – How to keep the number of decimal points consistent in the coefficients of formulas in ggplot?
I tried to lable two formulas on the figure ploted by ggplot. However, the number of decimal places in one formula does not match the number of decimal places of the other formula. Here is the original data: df<-structure(list(Treatment = c(“Irrigated”, “Irrigated”, “Irrigated”, “Irrigated”, “Irrigated”, “Irrigated”, “Irrigated”, “Irrigated”, “Irrigated”, “Irrigated”,…
r – How to adjust labels of loadings in ggplot?
I can’t get the labels to go at the end of the arrows instead of the base: here is the exact code I used: ggplot <- ggplot(data=sep_total_raw_data, aes(x=pc1t, y=pc2t))+geom_point(alpha=0.8, size=1,aes(colour=Data_Type, shape=Data_Type))+xlab(“PC1 (53.83%)”)+ylab(“PC2 (26.3%)”)+guides(colour=guide_legend(title=”Data_Type”))+geom_mark_hull(concavity=5, expand=0, radius=0, aes(fill=Data_Type))+theme(panel.grid = element_blank(), panel.border = element_rect(fill = “transparent”))+geom_text(aes(label=Code, fontface=”bold”, colour=Data_Type)) ggplot + geom_segment(data = PCA_loadings,…
Improve presentation of logistic regression plot R ggplot2
To reverse the order of the lines convert the variable mapped on group to a factor and reverse the order of the levels which could be achieved in one go using forcats::fct_rev. To get rid of the legend you could use a geom_text or a geom_label to add the labels…
ncRNA | Free Full-Text | The Potential microRNA Prognostic Signature in HNSCCs: A Systematic Review
Jung et al., 2012 [24] USA RT 17 OSCC (Tongue base 6, Tongue anterior 3, Tongue border 2, Tongue ventral, Mouth 1, Oropharynx 1, Tongue unspecified 2) miR-7, miR-21, miR-424 180 17 Ma 34–81 \ \ HPV +10, −7 pTNM stage I 1, II 5, IV 8, 3 N\A Kawakita…
Early screening of nasopharyngeal carcinoma
Review doi: 10.1002/hed.27466. Online ahead of print. Affiliations Expand Affiliations 1 Department of Otolaryngology Head and Neck Surgery, The First Affiliated Hospital, Jinan University, Guangzhou, China. 2 Department of Otolaryngology Head and Neck Surgery, Zhongshan City People’s Hospital, Zhongshan City, Guangdong Province, China. 3 Department of Otolaryngology Head and Neck…
CRISPR Cas12a-mediated amplification-free digital DNA assay improves the diagnosis and surveillance of Nasopharyngeal carcinoma
. 2023 Jul 23;237:115546. doi: 10.1016/j.bios.2023.115546. Online ahead of print. Affiliations Expand Affiliations 1 State Key Laboratory of Oncology in South China, Guangdong Key Laboratory of Nasopharyngeal Carcinoma Diagnosis and Therapy, Sun Yat-sen University Cancer Center, Guangzhou, 510060, China. 2 School of Medicine, South China University of Technology, Guangzhou, 510180,…
Reduced Vrk2 expression is associated with higher risk of depression in humans and mediates depressive-like behaviors in mice | BMC Medicine
The strategy and logic of choosing VRK2 SNPs for genetic analyses We retrieved the summary statistics of VRK2 SNPs in 23andMe, UK Biobank, and PGC2 samples [2, 3], and 256 SNPs region were available in all three GWAS datasets (a total of 246,363 cases and 561,190 controls). An overview about…
Junshi Biosciences Announces Initiation of Phase 3 Study of
SHANGHAI, China, June 29, 2023 (GLOBE NEWSWIRE) — Shanghai Junshi Biosciences Co., Ltd (“Junshi Biosciences,” HKEX: 1877; SSE: 688180), a leading innovation-driven biopharmaceutical company dedicated to the discovery, development, and commercialization of novel therapies, announced that the U.S. Food and Drug Administration (“FDA”) has recently agreed a randomized, double-blind, placebo-controlled,…
Solved PLEASE PROVIDE RSTUDIO CODE AND SCREENSHOTRun a
PLEASE PROVIDE RSTUDIO CODE AND SCREENSHOT Run a logistic regression model of PREFERENCE on all independent variables. Data is divided as 70% training, 30% testing data. Use only the training data set for estimating the model. Use a cutoff of 0.5 and do the classification. Compute the confusion matrix for…
where is mitochondrial dna found
Mitochondrial dysfunction and oxidative stress in neurodegenerative diseases. sFluorescence images of Calcein AM/PI staining in the CsA- or DMSO-treated NPCs. NPC pyroptosis mechanism via mtDNA mediated TLR9-NF-B-NLRP3 axis activation is unclear. In addition, we found that TLR9 recognized and bound mtDNA, which is critical for NF-B and the NLRP3 inflammasome…
XOMA Acquires Royalty and Milestone Economics to Phase 3 First-In-Class Orphan Disease Asset for Niemann-Pick Disease Type C (NPC) and Phase 2 Oncology Asset – XOMA (NASDAQ:XOMA), XOMA (NASDAQ:XOMAO)
EMERYVILLE, Calif., June 22, 2023 (GLOBE NEWSWIRE) — XOMA Corporation XOMA, announced today it has acquired the royalty and milestone rights associated with two assets from LadRx Corporation: arimoclomol, an oral therapeutic for Niemann-Pick disease type C, and aldoxorubicin, an albumin-linked formulation of doxorubicin. Arimoclomol is a first-in-class investigational therapy…
XOMA Acquires Royalty and Milestone Economics to Phase 3 First-In-Class Orphan Disease Asset … | News
EMERYVILLE, Calif., June 22, 2023 (GLOBE NEWSWIRE) — XOMA Corporation (NASDAQ: XOMA), announced today it has acquired the royalty and milestone rights associated with two assets from LadRx Corporation: arimoclomol, an oral therapeutic for Niemann-Pick disease type C, and aldoxorubicin, an albumin-linked formulation of doxorubicin. Arimoclomol is a first-in-class investigational…
Integrated multi-omics for rapid rare disease diagnosis on a national scale
Ethics The Australian Genomics Acute Care study has Human Research Ethics Committee approval (HREC/16/MH/251). Parents provided informed consent for participation in the study, following genetic counseling. Study design and participants The Acute Care Genomics program is a national multi-site study delivering ultra-rapid genomic testing to critically ill pediatric patients with…
element_textbox function – RDocumentation
Usage element_textbox( family = NULL, face = NULL, size = NULL, colour = NULL, fill = NULL, box.colour = NULL, linetype = NULL, linewidth = NULL, hjust = NULL, vjust = NULL, halign = NULL, valign = NULL, lineheight = NULL, margin = NULL, padding = NULL, width = NULL,…
protein abrupt-like isoform x1, maker-scaffold97_size377342-snap-gene-2.14 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of protein abrupt-like isoform x1 vs. L. salmonis genes Match: EMLSAG00000011120 (supercontig:LSalAtl2s:LSalAtl2s753:207020:208693:1 gene:EMLSAG00000011120 transcript:EMLSAT00000011120 description:”augustus_masked-LSalAtl2s753-processed-gene-1.1″) HSP 1 Score: 342.043 bits (876), Expect = 1.286e-109Identity = 269/559 (48.12%), Postives = 311/559 (55.64%), Query Frame = 0 Query: 168 DNFGPSAPKRHRFNGPESRNSPSSSPKSLADWGRRSLEPKTEDTAEADNNNSTPKSESLLSQALEKHSNVSSMYDRHLLRDNGDGRDGDSASDTTSERPESLMDGLIKNSGAESELHRQLSAASPASMGGHLFPPGLEALYRQAGFPSAFLGLAAGAA—-GGSPGG————–PVSSMHGLASSVPQVGLQSHAGNPN—————————————–LAGKLDMMRVRATDPRPCPKCGKIYRSAHTLRTHMEDKHTICPGYRCVLCGTVAKSRNSLHSHMSRQHRGISTKDLPVLPMPSPFDPALASRLLAKAGVKVTPNELAARASPTAPRRSDLPKLDTNLLHM-HHHQFPLPPSLPT-SMSGHMGRGSHDGNGSDVEDLRVSSAPSPFGSNGGPGGIYSQAHQMRIAQGMLSPKDFA–ALASAGGAQGAAGMGSALLDTYLSMI-AAAGGDSNPMAAALNFQ-NPASRAAAFAAAAAAASGNQAHNGDGKDNDQRSGVSEDRDDMTGELGSDADNDDLSDNDD 661 D++ P PKRHR NG E…
Methanol fixation is the method of choice for droplet-based single-cell transcriptomics of neural cells
hiPSC cell culture and differentiation hiPSCs were maintained on 1:40 matrigel (Corning, #354277) coated dishes in supplemented mTeSR-1 medium (StemCell Technologies, #85850) with 500 U ml−1 penicillin and 500 mg ml−1 streptomycin (Gibco, #15140122). For the differentiation of cortical neurons the protocol described previously21 was followed with slight modifications. Briefly, hiPSC colonies were seeded…
r – How to calculate the exponential equation in ggplot2?
I am trying to fit the exponential line to the points. It is working. But the linear formula appears in the diagram. I would appreciate someone telling me how to make the exponential formula in the plot. Nu treat pH Cd 1 Soil 6.1 0.28 2 Soil 6.1 0.29 3…
Investegate |Junshi Biosciences Announcements | Junshi Biosciences: Junshi Biosciences Announces Toripalimab plus Chemotherapy Significantly Improved Event-free Survival (EFS) versus Chemotherapy as Perioperative Treatment for Resectable Stage III Non-small Cell Lung Cancer (NSCLC) in Phase 3 Neotorch Study
Junshi Biosciences Announces Toripalimab plus Chemotherapy Significantly Improved Event-free Survival (EFS) versus Chemotherapy as Perioperative Treatment for Resectable Stage III Non-small Cell Lung Cancer (NSCLC) in Phase 3 Neotorch Study Perioperative toripalimab plus chemotherapy significantly improved EFS and reduced risk of disease recurrence, progression events or death by 60% among…
r – ggplot2: Legend with barplot and line
One option would be to first add a linetype scale and legend. Doing so allows to keep the outline in the legend for the geom_bar while removing the line glyph. Removing the outline for the geom_line is more tricky. Haven’t found a way to do so via override.aes. So I…
SUMOylation mediates the disassembly of the Smad4 nuclear export complex via RanGAP1 in KELOIDS
. 2023 Apr;27(8):1045-1055. doi: 10.1111/jcmm.17216. Epub 2023 Mar 14. Affiliations Expand Affiliations 1 Department of Plastic and Reconstructive Surgery, Zhejiang Provincial People’s Hospital, People’s Hospital of Hangzhou Medical College, Hangzhou, China. 2 Ningbo Hwamei Hospital, University of Chinese Academy of Sciences, Ningbo, Zhejiang, China. 3 Department of Plastic Surgery, The…
IJMS | Free Full-Text | An Efficient 2D Protocol for Differentiation of iPSCs into Mature Postmitotic Dopaminergic Neurons: Application for Modeling Parkinson’s Disease
Received: 28 February 2023 / Revised: 31 March 2023 / Accepted: 5 April 2023 / Published: 14 April 2023 Round 1 Reviewer 1 Report The article written by Lebedeva and colleagues descrives a 2D protocol useful for the differentiation of iPSCs into mature postmitotic DA-neurons in feeder-free and integration-free conditions….
Can This Medical Herb Help Fight Tumors?
Skullcap (Scutellaria barbata) has impressive antitumor properties, making it a potential treatment for chronic disease, in part due to its active ingredient scutebarbatine A. Story at a Glance Skullcap (Scutellaria barbata) is a traditional Chinese medicine (TCM) plant known in China as banzhilian. Researchers used DNA sequencing to uncover how…
Epic Gems, Raids, Loots, Events & More Items
Now that we’re well into phase 2 of Wrath of the Lich Classic and if you want to take a look forward as to what will be coming up in phase 3, so today we’ll be checking out WOTLK Classic phase 3 release date, and what’s new what to expect…
N6-methyladenosine modification in 18S rRNA promotes tumorigenesis and chemoresistance via HSF4b/HSP90B1/mutant p53 axis
. 2023 Feb 16;30(2):144-158.e10. doi: 10.1016/j.chembiol.2023.01.006. Affiliations Expand Affiliations 1 Department of Breast Cancer, Guangdong Provincial People’s Hospital, Guangdong Academy of Medical Sciences, Southern Medical University, 106 Zhongshan Er Road, Yuexiu District, Guangzhou 510080, P.R. China; State Key Laboratory of Oncology in South China, Guangdong Key Laboratory of Nasopharyngeal Carcinoma…
Junshi Biosciences Announces Toripalimab in Combination with Chemotherapy for Treatment of Advanced Triple-negative Breast Cancer Met Primary Endpoint in Phase 3 Clinical Study
This section is Partnership Content supplied The content in this section is supplied by GlobeNewswire for the purposes of distributing press releases on behalf of its clients. Postmedia has not reviewed the content. by GlobeNewswire Breadcrumb Trail Links GlobeNewswire Author of the article: Published Feb 20, 2023 • Last updated…
New Cell Culture, Analysis Approach Helps Explain Differences in Zika Virus Susceptibility
NEW YORK – A team led by researchers at the Broad Institute has demonstrated the potential of using so-called cell villages from several donors to characterize expression variability in neural progenitor cells (NPC), along with related genetic features that appear to influence brain function and vulnerability to Zika virus infection….
Junshi Biosciences and Coherus Announce Positive Final Overall Survival Results of JUPITER-02, a Phase 3 Clinical Trial Evaluating Toripalimab as Treatment for Recurrent or Metastatic Nasopharyngeal Carcinoma
This section is Partnership Content supplied The content in this section is supplied by GlobeNewswire for the purposes of distributing press releases on behalf of its clients. Postmedia has not reviewed the content. by GlobeNewswire Breadcrumb Trail Links GlobeNewswire Article content – Final overall survival analysis of the JUPITER-02 trial…
Fluorescent aptasensor based on the MNPs-CRISPR/Cas12a-TdT for the determination of nasopharyngeal carcinoma-derived exosomes
doi: 10.1007/s00604-023-05657-7. Affiliations Expand Affiliations 1 Department of Radiotherapy, Hubei Cancer Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan, 430074, Hubei, China. 2 Department of Pharmacy, Zigong Third People’s Hospital, Zigong, 643020, Sichuan, China. 3 Department of Otorhinolaryngology Head and Neck Surgery, Shenzhen Fuyong People’s Hospital, Shenzhen,…
r – How can I make the legend color bar the same height as my plot panel?
The problem is that the plot panel does not have defined dimensions until drawing (“NULL unit”), but your legend guide has. See also npc coordinates of geom_point in ggplot2 or figuring out panel size given dimensions for the final plot in ggsave (to show count for geom_dotplot). I think it…
ggplot2 – Adding horizontal title/label to bar charts in ggplot R
The default approach to achieve the kind of grouping would be via faceting, However, TBMK the default element_rect provided by ggplot2 does not offer the option to just draw a top line. One option would be to create a custom theme element to achieve that. To this end I adapted…
circRNF13 Inhibits the Proliferation and Metastasis of Nasopharyngeal Carcinoma through SUMO2
Circular RNAs (circRNAs) are widely expressed in human cells and are closely related to the development of cancer. However, they are rarely studied in the context of nasopharyngeal carcinoma (NPC). Here, the researchers found that a novel circRNF13 was stably expressed at low levels in clinical tissues and cells of…
Description, Programming Languages, Similar Projects of ggfx
ggfx is a (currently experimantal) package that allows the use of various filters and shaders on ggplot2 layers. Installation You can install ggfx from CRAN in the usual manner (install.packages(‘ggfx’)) or you can grab the development version directly from github using the devtools package: # install.packages(‘devtools’) devtools::install_github(‘thomasp85/ggfx’) Example The basic…
Mechanism for DNA invasion of adenoviral Covi
image: Incoming adenovirus particles (AdV) dock at the nuclear pore complexes of a human cell’s nucleus (NPC, dashed line). The cellular enzyme Mind bomb1 (Mib1, grey-white structures) primes them for unlocking and removes protein V (GFP-V, green dots). The uncoated viral DNA genome is then imported into the nucleus. The arrow…
ggplot, drawing multiple lines across facets
ggplot, drawing multiple lines across facets I drew two panels in a column using ggplot2 facet, and would like to add two vertical lines across the panels at x = 4 and 8. The following is the code: library(ggplot2) library(gtable) library(grid) dat <- data.frame(x=rep(1:10,2),y=1:20+rnorm(20),z=c(rep(“A”,10),rep(“B”,10))) P <- ggplot(dat,aes(x,y)) + geom_point() +…
Using comm to make a list of files that haven’t yet been processed
Using comm to make a list of files that haven’t yet been processed 0 I’m using comm to work out which files have already been processed and which are still to do. The input and output filenames are a little different, so I’ve used basename and sed to strip away…
gmod how to animate ragdolls
Now that you know nearly all the possibilities in this mod, let’s go even more deeper. Oct 15, 2019. Continue browsing in r/gmod. The original TF2 on the other hand is very easy to face pose, because you can literally move just 1 silder, and then you got a “happy…
gmod animation commands
Intensity of magnade’s attraction to a hunter. Learn how your comment data is processed. Find key bound to specified command string. Insomnia65 August 12, 2019 – TF2 Team. if you find this, don’t go around enabling it and then complaining about issues. The “size in K” is the block size…
gmod advanced duplicator 2
Advanced Duplicator 2 is a Garry’s Mod addon which implements a tool similar to the Duplicator, but with many added features. Yeah no problem mate, thanks for the response. I’m done with gmod and I don’t take requests, so please stop spamming the comment section. “Originally published in single magazine…
gmod prop hunt not working
I’ve let the server stay open so you can join it and test for yourself. Game Garry’s Mod. It’s just textures (and maps, if you need it) for use as an addon to Garry’s Mod. From hunting down everyday objects in Prop Hunt to strangling and trampling pigs in Open…
New Techniques and Complex Models
CRISPR systems that rely on inactivated Cas enzymes—that is, dead Cas (dCas) enzymes—never looked more alive. They harness the targeting power associated with CRISPR—but not the double-strand cuts. As such, they give researchers new ways to interrogate and manipulate gene function. Possibilities include CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa)…