Tag: nu

Non-random tissue distribution of mutant mtDNA – ePrints

Non-random tissue distribution of mutant mtDNA Lookup NU author(s): Professor Patrick Chinnery, Professor Mark Walker, Professor Robert Taylor, Professor Robert Lightowlers, Professor Laurence Bindoff, Emeritus Professor Doug Turnbull Downloads Full text for this publication is not currently held within this repository. Alternative links…

Continue Reading Non-random tissue distribution of mutant mtDNA – ePrints

python – How to implement Bayesian Inference correctly with pymc3?

I have been working with pymc3 for a while and I was observing the several tutorials with examples. However, I am not sure if I am approaching the Bayesian InFerence method correctly. Find below my approach: from pymc3.distributions import Interpolated import numpy as np # import warnings # import sys…

Continue Reading python – How to implement Bayesian Inference correctly with pymc3?

query sequence is input sequence or its reverse complement

query sequence is input sequence or its reverse complement 0 >sp|O14920.1|IKKB_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase subunit beta; Short=I-kappa-B-kinase beta; Short=IKK-B; Short=IKK-beta; Short=IkBKB; AltName: Full=I-kappa-B kinase 2; Short=IKK2; AltName: Full=Nuclear factor NF-kappa-B inhibitor kinase beta; Short=NFKBIKB; AltName: Full=Serine/threonine protein kinase IKBKB MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT LAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLM LMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED QELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSI…

Continue Reading query sequence is input sequence or its reverse complement

Phylogeographic reconstruction of the marbled crayfish origin

Procambarus fallax collections and PCR genotyping Animals were collected from various wild populations (Table S1) in compliance with state and local regulations (Georgia department of natural resources scientific collection permit 115621108, state of Florida collection permits S-19-10 and S-20-04). DNA was isolated from abdominal muscle tissue using SDS-based extraction and precipitation…

Continue Reading Phylogeographic reconstruction of the marbled crayfish origin

Genomic and phenotypic characteristics for Vibrio vulnificus

Background Fisheries and aquaculture are becoming increasingly intensive to meet recent human consumption, resulting in proliferation of marine pathogens and food security concerns.1,2 Vibrio species, as one of the most dangerous foodborne pathogens, cause vibriosis in human around the world.3 It has been reported that vibriosis resulted in 80,000 illnesses…

Continue Reading Genomic and phenotypic characteristics for Vibrio vulnificus

Specific targeting of a DNA-alkylating reagent to mitochondria: Synthesis and characterization of [4-((11aS)-7-methoxy-1,2,3,11a-tetrahydro-5H-pyrrolo[2,1-c][1,4] benzodiazepin-5-on-8-oxy)butyl]-triphenylphosphonium iodide – ePrints

Specific targeting of a DNA-alkylating reagent to mitochondria: Synthesis and characterization of [4-((11aS)-7-methoxy-1,2,3,11a-tetrahydro-5H-pyrrolo[2,1-c][1,4] benzodiazepin-5-on-8-oxy)butyl]-triphenylphosphonium iodide Lookup NU author(s): Professor Robert Lightowlers, Dr Paul Smith Downloads Full text for this publication is not currently held within this repository. Alternative links are provided below where…

Continue Reading Specific targeting of a DNA-alkylating reagent to mitochondria: Synthesis and characterization of [4-((11aS)-7-methoxy-1,2,3,11a-tetrahydro-5H-pyrrolo[2,1-c][1,4] benzodiazepin-5-on-8-oxy)butyl]-triphenylphosphonium iodide – ePrints

Research Fellow / Senior Research Assistant (Bioinformatics) at Northumbria University

Northumbria University is a member of the COVID-19 Genomics UK Consortium (COG-UK).  COG-UK is a pioneer in the use of large-scale, rapid whole-genome sequencing of SARS-CoV-2, the virus causing the COVID-19 pandemic, to understand viral transmission and evolution, and to inform public health responses and vaccine development. We seeking to…

Continue Reading Research Fellow / Senior Research Assistant (Bioinformatics) at Northumbria University

Assembly with repetitive regions

Assembly with repetitive regions 0 Hello all! I am assembling a synthetic genome sequenced with Oxford Nanopore. The problem is that I obtain a very repetitive assembly with all the contigs such as ATATATATATATATATAT. I do not understand why because I have repeated the process with the Acinetobacter pittii genome,…

Continue Reading Assembly with repetitive regions

A new mtDNA point mutation on tRNA Ser(UCN) in a cardiomyopathic patient – ePrints

A new mtDNA point mutation on tRNA Ser(UCN) in a cardiomyopathic patient Lookup NU author(s): Professor Laurence Bindoff, Dr Margaret Johnson, Professor Robert Lightowlers Downloads Full text for this publication is not currently held within this repository. Alternative links are provided below where…

Continue Reading A new mtDNA point mutation on tRNA Ser(UCN) in a cardiomyopathic patient – ePrints

Pericentromeric noncoding RNA changes DNA binding of CTCF and inflammatory gene expression in senescence and cancer

Significance During the aging process, senescent cells secrete inflammatory factors, causing various age-related pathologies. Thus, controlling the senescence-associated secretory phenotype (SASP) can tremendously benefit human health. Although SASP seems to be induced by the alteration of chromosomal organization, its underlying mechanism remains unclear. Here, it has been revealed that noncoding…

Continue Reading Pericentromeric noncoding RNA changes DNA binding of CTCF and inflammatory gene expression in senescence and cancer

De novo genome assembly

Forum:De novo genome assembly 0 Howdy, I have recently been tasked as the ‘bioinformatics guy” in my lab and am having trouble with a de novo genome assembly of Mother of a Thousand. I am working with Nanopore reads and have ran my reads through CANU. I have all of…

Continue Reading De novo genome assembly