Tag: QA

Remote Software Quality Engineer III – Bioinformatics Job at Natera

JOB TITLE: Software Quality Engineer III – Bioinformatics LOCATION: Remote, USA PRIMARY RESPONSIBILITIES: Perform software verification, define and execute test cases and scenarios required for software quality assurance and regulatory compliance. Perform system analysis, assess risk, and develop strong test strategies by analyzing product design and technical specifications, and by…

Continue Reading Remote Software Quality Engineer III – Bioinformatics Job at Natera

slurm fails on disconnected standalone computer/node

Hi, I have a setup similar to the one of the original reporter. My NodeName is localhost . The error messages at booting time scared me, so I dug the issue. I also related this issue to my observation that slurm fails to launch jobs when my standalone computer is…

Continue Reading slurm fails on disconnected standalone computer/node

Google Vertex AI | Haystack

Use Google Vertex AI Models with Haystack Authors deepset Table of Contents Overview Vertex AI is a machine learning (ML) platform that lets you train and deploy ML models and AI applications, and customize large language models (LLMs) for use in your AI-powered applications. This integration enables the usage of…

Continue Reading Google Vertex AI | Haystack

Getting 401 in openapi scan for authenticated APIs.

Hi all I am trying to perform scan on an openapi definition file (api-qa-clone.json) .Some APIs in this definition file are open and some require token in ‘Authorization’ request header. To achieve this I am using below multi-stage Dockerfile: FROM python AS pybuildWORKDIR /tmpCOPY zap_api_automation.py .COPY options.prop .COPY api-qa-clone.json .RUN…

Continue Reading Getting 401 in openapi scan for authenticated APIs.

AI Week In Review 23.12.16

Figure 1. Tesla’s Optimus Gen2 demo video, showing off tactile precision. Midjourney Alpha web interface is available here to super-users who generated over 10k Midjourney images. This will be a big UX upgrade for Midjourney users over the discord text prompt method. Google has released Imagen2 text-to-image generation for Vertex…

Continue Reading AI Week In Review 23.12.16

Report: Slow mobile app releases cost over $100,000 in lost revenue per year for 75% of companies

It’s no surprise that slow development processes are costing companies greatly, but by how much? According to a new report by the mobile testing company Kobiton, 75% of respondents said slow mobile app releases cost their company at least $100,000 each year, and 13% said it costs them between $1…

Continue Reading Report: Slow mobile app releases cost over $100,000 in lost revenue per year for 75% of companies

Bug#1058627: src:zope.proxy: fails to migrate to testing for too long: autopkgtest regression

Source: zope.proxy Version: 4.5.0-1 Severity: serious Control: close -1 5.1-2 Tags: sid trixie User: release.debian….@packages.debian.org Usertags: out-of-sync Dear maintainer(s), The Release Team considers packages that are out-of-sync between testing and unstable for more than 30 days as having a Release Critical bug in testing [1]. Your package src:zope.proxy has been…

Continue Reading Bug#1058627: src:zope.proxy: fails to migrate to testing for too long: autopkgtest regression

Google Launches AI Studio for Easy Access to Gemini Generative AI Model

on December 13, 2023 at 12:00 pm Google has unveiled AI Studio, a new web-based platform giving developers easy access to its recently announced Gemini AI large language models. The service lets builders quickly develop and deploy chatbots, apps, and other software powered by Gemini’s natural language generation capabilities, specifically…

Continue Reading Google Launches AI Studio for Easy Access to Gemini Generative AI Model

SRA Staffing – SRA Group hiring QA Analyst with Bioinformatics in Mississauga, Ontario, Canada

Title: QA Analyst with Bioinformatics Work location: Mississauga, Canada (Hybrid) Duration: 1 Year Plus Contract Job Description: B.S. or M.S. in Computer Science, Data Sciences, Bioinformatics, Biomedical engineering or equivalent field • Min 5 years of experience in software development or software test engineering or data engineering • Proficiency in…

Continue Reading SRA Staffing – SRA Group hiring QA Analyst with Bioinformatics in Mississauga, Ontario, Canada

pytorch-cluster: FTBFS: ImportError: Failed to load PyTorch C extensions:

Source: pytorch-cluster Version: 1.6.1-2 Severity: serious Justification: FTBFS Tags: trixie sid ftbfs User: lu…@debian.org Usertags: ftbfs-20231212 ftbfs-trixie Hi, During a rebuild of all packages in sid, your package failed to build on amd64. Relevant part (hopefully): > debian/rules clean > dh clean –buildsystem pybuild > dh_auto_clean -O–buildsystem=pybuild > I: pybuild…

Continue Reading pytorch-cluster: FTBFS: ImportError: Failed to load PyTorch C extensions:

Bioinformatics Programmer in New York, NY for Columbia University

Details Posted: 01-Dec-23 Location: New York, New York Type: Full-time Salary: Open Categories: Staff/Administrative Job Type: Officer of Administration Bargaining Unit: Regular/Temporary: Regular End Date if Temporary: Hours Per Week: 35 Standard Work Schedule: M-F 9am-5pm Building: Salary Range: $80,000 – $95,000 The salary of the finalist selected for this…

Continue Reading Bioinformatics Programmer in New York, NY for Columbia University

Bioinformatics Programmer – Columbia University Medical Center, New York, United States

Bioinformatics Programmer Columbia University Medical Center Job Type: Officer of Administration Bargaining Unit: Regular/Temporary: Regular End Date if Temporary: Hours Per Week: 35 Standard Work Schedule: M-F 9am-5pm Building: Salary Range: $80,000 – $95,000 The salary of the finalist selected for this role will be set based on a variety…

Continue Reading Bioinformatics Programmer – Columbia University Medical Center, New York, United States

Scientific collaboration paves the way to cleaner technologies for industry

Interdisciplinarity and an exchange of innovative ideas allowed researchers to gain insights into the structure and function of a heat-resistant enzyme found in an exotic microbe living in extreme conditions. Credit: Isabel Romero Calvo/EMBL During the nearly five decades of its operation, the European Molecular Biology Laboratory (EMBL) in Hamburg…

Continue Reading Scientific collaboration paves the way to cleaner technologies for industry

[Hiring] QA Engineer Release Manager @Lifebit Biotech Ltd at Lifebit Biotech Ltd

Nov 22, 2023 – Lifebit Biotech Ltd is hiring a remote QA Engineer Release Manager. 📍Location: Europe. At Lifebit, we carve our own path. We’re open-source pioneers and our driving mission is to revolutionise bioinformatics and biomedical data analysis forever. Our product, Lifebit CloudOS, is the world’s first federated genomics…

Continue Reading [Hiring] QA Engineer Release Manager @Lifebit Biotech Ltd at Lifebit Biotech Ltd

Bug#1056217: src:rust-async-task: fails to migrate to testing for too long: autopkgtest regression

Source: rust-async-task Version: 4.4.1-1 Severity: serious Control: close -1 4.5.0-1 Tags: sid trixie User: release.debian….@packages.debian.org Usertags: out-of-sync Control: block -1 by 1055099 Dear maintainer(s), The Release Team considers packages that are out-of-sync between testing and unstable for more than 30 days as having a Release Critical bug in testing [1]….

Continue Reading Bug#1056217: src:rust-async-task: fails to migrate to testing for too long: autopkgtest regression

Assistant Professor Bioinformatics Jobs in Islamabad 2023 Page 2

Job Vacancies at Higher Education Commission HEC Higher Education Commission HEC, Islamabad, Islamabad, Pakistan Vacancies: | Project Director | Project Manager | Account Manager | Project Assistant | Naib Qasid | Driver | Nov 13, 2023 – Apply Now‎ Vacancy Announced at Public Sector Private Limited Company Islamabad Public Sector…

Continue Reading Assistant Professor Bioinformatics Jobs in Islamabad 2023 Page 2

US Department of Agriculture (USDA) Agricultural Research Service (ARS) hiring Biologist (Computational Bioinformatics) in Las Cruces, NM

Summary This position is in the Agricultural Research Service (ARS), Field Organization, Plains Area (PA), Range Management Research Unit located in Las Cruces, NM. In this position, you will be responsible for integrating existing databases and identifying and implementing procedures for analysis of vegetation, climate and soil data in agroecosystems…

Continue Reading US Department of Agriculture (USDA) Agricultural Research Service (ARS) hiring Biologist (Computational Bioinformatics) in Las Cruces, NM

Electroporation Transformation of Barley | SpringerLink

Ahloowalia BS (1987) Plant regeneration from embryo-callus culture in barley. Euphytica 36: 659–665 CrossRef  Google Scholar  Ahokas H (1989) Transfection of germinating barley seed electrophoretically with exogenous DNA. Theor Appl Genet 77: 469–472 CrossRef  CAS  Google Scholar  Barro F, Cannell ME, Lazzeri PA, Barcelo P (1998) The influence of auxins…

Continue Reading Electroporation Transformation of Barley | SpringerLink

RCSB PDB – 8PBD: RAD51 filament on dsDNA bound by the BRCA2 c-terminus

ATPQuery on ATP Download Ideal Coordinates CCD File&nbsp CA [auth C]FA [auth D]IA [auth E]LA [auth F]OA [auth G] CA [auth C],FA [auth D],IA [auth E],LA [auth F],OA [auth G],RA [auth H],UA [auth I],V [auth A],XA [auth J],Z [auth B] Less ADENOSINE-5′-TRIPHOSPHATEC10 H16 N5 O13 P3ZKHQWZAMYRWXGA-KQYNXXCUSA-N CAQuery on CA Download…

Continue Reading RCSB PDB – 8PBD: RAD51 filament on dsDNA bound by the BRCA2 c-terminus

Technical Integration Engineer (CH963) – IT-Online

Our client, a leading payments service provider, is looking for a Technical Integration Engineer to join their growing team. The Integration Engineer will be dedicated to supporting, testing, and managing our client’s various online API integration projects and will support a more focused approach to integrations, enriched client support and…

Continue Reading Technical Integration Engineer (CH963) – IT-Online

Enhancing alphafold-multimer-based protein complex structure prediction with MULTICOM in CASP15

The comparison between MULTICOM servers and other CASP15 server assembly predictors According to the CASP15 official assessment (see the official ranking predictioncenter.org/casp15/zscores_multimer.cgi), MULTICOM_qa and MULTICOM_deep servers ranked 3rd and 5th among all CASP15 assembly server predictors. The MULTICOM human predictors (MULTICOM_human and MULTICOM) ranked 7th and 10th among all CASP15…

Continue Reading Enhancing alphafold-multimer-based protein complex structure prediction with MULTICOM in CASP15

Top 8 Generative AI Jobs in India

As per a report by Goldman Sachs, generative AI holds the promise of boosting global GDP by 7%, equivalent to nearly $7 trillion and boosting productivity growth by 1.5 percentage points over a decade. Currently, there’s a widespread trend of enhancing capabilities in generative AI across startups and major tech…

Continue Reading Top 8 Generative AI Jobs in India

Bioinformatics Data Quality Specialist – Elucidata Comp Biology

“Looking for a Data Quality Specialist? Join Elucidata Bioinformatics and make a difference in computational biology!” Bioinformatics Data Quality Specialist – Elucidata Comp Biology & Biotech Apply About Elucidata Bioinformatics Elucidata is a leading biotech company that specializes in computational biology. We are dedicated to delivering high-quality biomedical data to…

Continue Reading Bioinformatics Data Quality Specialist – Elucidata Comp Biology

Bug#1055223: src:slurm-wlm-contrib: fails to migrate to testing for too long: missing binaries

Source: slurm-wlm-contrib Version: 23.02.3-2.1 Severity: serious Control: close -1 23.02.6-1 Tags: sid trixie User: release.debian….@packages.debian.org Usertags: out-of-sync Dear maintainer(s), The Release Team considers packages that are out-of-sync between testing and unstable for more than 30 days as having a Release Critical bug in testing [1]. Your package src:slurm-wlm-contrib has been…

Continue Reading Bug#1055223: src:slurm-wlm-contrib: fails to migrate to testing for too long: missing binaries

Retrieval Augmented Generation (RAG) tutorial using VertexAI Gen AI and Langchain

Introduction In today’s rapidly evolving digital landscape, the rise of Generative AI has been nothing short of remarkable. This fascinating branch of artificial intelligence has gained significant momentum, enabling us to harness the limitless potential of AI-powered creativity. At the forefront of this creative revolution stands Vertex AI, Google Cloud’s…

Continue Reading Retrieval Augmented Generation (RAG) tutorial using VertexAI Gen AI and Langchain

Bug#1054792: lammps: FTBFS: dh_install: error: missing files, aborting

Source: lammps Version: 20220106.git7586adbb6a+ds1-2 Severity: serious Justification: FTBFS Tags: trixie sid ftbfs User: lu…@debian.org Usertags: ftbfs-20231027 ftbfs-trixie Hi, During a rebuild of all packages in sid, your package failed to build on amd64. Relevant part (hopefully): > make[2]: Entering directory ‘/<<PKGBUILDDIR>>/debian/build’ > make[2]: Nothing to be done for ‘preinstall’. >…

Continue Reading Bug#1054792: lammps: FTBFS: dh_install: error: missing files, aborting

Exact Sciences hiring Senior Bioinformatics QA Engineer in Cambridge, MA

Position OverviewThe Senior Bioinformatics QA Engineer will play a pivotal role in ensuring the quality and reliability of our bioinformatics software pipelines. This role works closely with our software development and bioinformatics teams to develop and execute comprehensive testing strategies. The incumbent’s expertise will be essential in identifying and resolving…

Continue Reading Exact Sciences hiring Senior Bioinformatics QA Engineer in Cambridge, MA

Top 10 tips on how to start an early phase clinical trial

By the clinical operations and medical affairs experts at drug development consultancy Boyds Early phase clinical trials can be complicated and time-consuming, with their success dependent on several different factors. The outcome of these early phase trials will determine the future of your drug development project, and so ensuring safety…

Continue Reading Top 10 tips on how to start an early phase clinical trial

Senior Software QA Engineer, Platform @ RStudio

Posit is seeking a QA engineer with strong automation and environment provisioning skills to join our Platform Team. The team works across all Posit products, developing shared components and enabling customers to use the products better. This is a high-leverage team that can impact many people and customers. You’ll be…

Continue Reading Senior Software QA Engineer, Platform @ RStudio

no longer buildable on armel

Source: cp2k Version: 2023.1-2 Severity: serious Control: close -1 2023.2-1 Tags: sid trixie User: release.debian….@packages.debian.org Usertags: out-of-sync Dear maintainer(s), The Release Team considers packages that are out-of-sync between testing and unstable for more than 30 days as having a Release Critical bug in testing [1]. Your package src:cp2k has been…

Continue Reading no longer buildable on armel

SMEDIX INC Senior Bioinformatics Systems Software Test Engineer

About us Our goal is to accelerate innovation in healthcare through partnerships to bring high-quality software solutions and technologies to market. Essential Duties and Responsibilities: Work with bioinformatics SQA engineers and members of a bioinformatics group to develop test cases that ensure the quality of bioinformatics software used in FDA…

Continue Reading SMEDIX INC Senior Bioinformatics Systems Software Test Engineer

Bug#1053845: src:r-cran-rcppannoy: fails to migrate to testing for too long: autopkgtest regression

Source: r-cran-rcppannoy Version: 0.0.20-1 Severity: serious Control: close -1 0.0.21-1 Tags: sid trixie User: release.debian….@packages.debian.org Usertags: out-of-sync Dear maintainer(s), The Release Team considers packages that are out-of-sync between testing and unstable for more than 30 days as having a Release Critical bug in testing [1]. Your package src:r-cran-rcppannoy has been…

Continue Reading Bug#1053845: src:r-cran-rcppannoy: fails to migrate to testing for too long: autopkgtest regression

[Bug 2242971] New: Review Request: python-torch

bugzilla.redhat.com/show_bug.cgi?id=2242971 Bug ID: 2242971 Summary: Review Request: python-torch – PyTorch Product: Fedora Version: rawhide OS: Linux Status: NEW Component: Package Review Severity: medium Assignee: nobody@xxxxxxxxxxxxxxxxx Reporter: trix@xxxxxxxxxx QA Contact: extras-qa@xxxxxxxxxxxxxxxxx CC: package-review@xxxxxxxxxxxxxxxxxxxxxxx Target Milestone: — Classification: Fedora Spec URL: trix.fedorapeople.org/python-torch.spec SRPM URL: trix.fedorapeople.org/python-torch-2.1.0-2.fc40.src.rpm This is a minimal, cpu only, no…

Continue Reading [Bug 2242971] New: Review Request: python-torch

Automated Checks And QA

Forum:Automated Checks And QA 0 I’ve been reading this paper on a major data analysis error – see below. LINK:doi.org/10.1128/mbio.01607-23 ABSTRACT We re-analyzed the data from a recent large-scale study that reported strong correlations between DNA signatures of microbial organisms and 33 different cancer types and that created machine-learning predictors…

Continue Reading Automated Checks And QA

[Bug 2242399] New: Review Request: xnnpack

bugzilla.redhat.com/show_bug.cgi?id=2242399 Bug ID: 2242399 Summary: Review Request: xnnpack – A PyTorch neural net library Product: Fedora Version: rawhide OS: Linux Status: NEW Component: Package Review Severity: medium Assignee: nobody@xxxxxxxxxxxxxxxxx Reporter: trix@xxxxxxxxxx QA Contact: extras-qa@xxxxxxxxxxxxxxxxx CC: package-review@xxxxxxxxxxxxxxxxxxxxxxx Target Milestone: — Classification: Fedora Spec URL: trix.fedorapeople.org/xnnpack.spec SRPM URL: trix.fedorapeople.org/xnnpack-0.0%5egit20221221.51a9875-1.fc40.src.rpm XNNPACK is a…

Continue Reading [Bug 2242399] New: Review Request: xnnpack

How do you validate and verify your pipeline’s software updates?

Forum:How do you validate and verify your pipeline’s software updates? 0 I am curious to hear how everyone performs quality and assurance testing for updates to pipeline versions. It is reported that developers of bioinformatics pipelines spend 60% or more of their time testing their software. What strategies or tools…

Continue Reading How do you validate and verify your pipeline’s software updates?

Dice hiring Bioinformatician (bioinformatic software) in Indianapolis, Indiana, United States

Dice is the leading career destination for tech experts at every stage of their careers. Our client, American Technology Consulting LLC, is seeking the following. Apply via Dice today!Purpose of Position/Summary:Incumbent is responsible for the study, development, maintenance, and performance of cutting-edge next generation sequencing (NGS) based biological assays in…

Continue Reading Dice hiring Bioinformatician (bioinformatic software) in Indianapolis, Indiana, United States

ATC hiring Bioinformatician (bioinformatic software exp required) in Indianapolis, Indiana, United States

Purpose of Position/Summary: Incumbent is responsible for the study, development, maintenance, and performance of cutting-edge next generation sequencing (NGS) based biological assays in the areas of bacteriology, virology, and parasitology. In addition to the wet-lab testings this position also puts an emphasizes on the bioinformatics side of NGS utilizing advanced…

Continue Reading ATC hiring Bioinformatician (bioinformatic software exp required) in Indianapolis, Indiana, United States

3 1 Histogram.png – RStudio = – Edit Code View -yl Profile Tools O | Week-2R | Week-2 2R O | Week-2 3R # Create frequency plot ggplot data aes x =

RStudio–oX =EditCodeViewPlotsSessionBuildDebugProfileToolsHelp -ylB|&||AGotofile/function~Addins~&)Project:(None)~ O|Week2.RO|Week-2R@|Week-22RO|Week-2_3R©|Week-2.4R@|Week-2_1R=0EnvironmentHistoryConnectionsTutorial=0 5[JSourceonsave|QA/-SRun|*%|Psouce+|=&||7mportDataset~|@456MiB–|&ust–|@~ 8inspector_name<-data$INSPECTOR_NAME“R~|@lGlobalEnvironment~ 1(9)council_districts<-datascpCY]Listof9N 11#Createfrequencyplot©ggListof9 12ggplot(data,aes(x=inspector_name))+missing_indicesint[1,1:2]4173 13geom_histogram(stat=“count™)+Values 14labs(title=”plot”,.weEptMWownneppn“epp”“Spp”M Tsubtitle-“TnspectorVsTotalCases”,approved_usechr[1:505]“sFIXEDUSESFD”“SFD”“SFD”“DUPLE 16Caption—”BuildingReport”,areachr[1:505]“II”“III”“II”“I”“I”“III”“II”“I”“I”“L 17x=”Inspectors”,council_districtsint[1:505]1185641510228… 18y=”TotalCases”inspector_namechr[1:505]“IXRIOS”“NREID”“RTAGUINE”“RSIMONS”“RSIMON. mpg<Promise> 20g<goplot(data,aes(x—inspector_name)) 21g+geom_bar(aes(fi11-APPROVED_USE),width–0.6)+ 22Jabs(title=”HistogramonCategoricalVariable”,F=Wilboeers(5WBEmmEim 23subtitle=”InspectorVsTotalCases”,@AzoomFexport+O|&%Publish– 24caption=”BuildingReport”,.NNEERet 25x=”Inspectors”HistogramonCategoricalVariable[ 26y=”TotalCases”)InspectorVsTotalCases[ 27APT 28>2BnutorePar <» CHURCH 271(TopLevel)2RScript2.. Bcommercia ConsoleTerminal-~BackgroundJobs=0%0Woueiex RR430-~/ –labs(title=”HistogramonCategoricalvariable”,7|o[lHoreLmorEL ssubtitle=”ManufactureracrossVehicleClasses”)]BnoustrAL –g<~ggplot(data,aes(x=inspector_name))Sw0 –g+geom_bar(aes(fi11-APPROVED_USE),width=0.6)+MIeouse –#theme(axis.text.x=element_text(angle=65,viust=0.6))+gBoFFice –labs(title=”HistogramonCategoricalvariable”,Momer –subtitle=”ManufactureracrossVehicleClasses”) .30BFariinGLOT >g<=ggplot(data,aes(x=inspector_name))IResTauRANT –g+geom_bar(aes(fi11=APPROVED_USE),width=0.6)+ –Tabs(title=”HistogramonCategoricalvariable”,RETAL –subtitle=”InspectorVsTotalCases”,0——_——_—–_–_–|SCHOOL .caption=”BuildingReport”, –x=”Inspectors”369294GHERRERAJDUANEJXRIOSNREIDRSIMONSRTAGUINESFD –TotalCases™)Inspectors|sHED .–BuidingReport1]WAREHOUSE Read more here:…

Continue Reading 3 1 Histogram.png – RStudio = – Edit Code View -yl Profile Tools O | Week-2R | Week-2 2R O | Week-2 3R # Create frequency plot ggplot data aes x =

CAMRIS hiring Bioinformatics Scientist in Bethesda, MD

We are seeking a Bioinformatics Scientist to support the National Institutes of Health’s National Institute of Allergy and Infectious Diseases (NIAID) in Bethesda, MD. Our NIAID professional, technical, and scientific support personnel are part of a team focused on positively impacting millions of lives around the world. Candidates will work…

Continue Reading CAMRIS hiring Bioinformatics Scientist in Bethesda, MD

Perm Bioinformatics Specialist (WEST) #HZT x 1 / Permanent / Singapore / SGD- SGD – ONLINE JOBS

Perm Bioinformatics Specialist (WEST) #HZT Singapore | Posted: Sep 26, 2023 Deriving QA and QC guidelines pertaining to NGS data for in-house NGS workflows Develop novel algorithms for genome assembly, variant detection (SNPs and InDels) and structural variant detection (CNVs, Inversions and Translocations) for a clinical-grade genome analysis….

Continue Reading Perm Bioinformatics Specialist (WEST) #HZT x 1 / Permanent / Singapore / SGD- SGD – ONLINE JOBS

What is Google Cloud AutoML Vision?

Google has recently begun offering a large suite of AI tools to everyday businesses and ambitious software products that use Google platforms, perhaps from a capable Chromebook. One interesting example in the past few years is Google Cloud’s AutoML Vision. This tool to create image analysis models may soon shut…

Continue Reading What is Google Cloud AutoML Vision?

Commonly collected thermal performance data can inform species distributions in a data-limited invader

Animal collection and housing Ten chameleons were captured from an established non-native population in Central Florida from October 2019-February 2020 (N = 7 males, 2 females) and October 2020 (N = 1 male). Adult panther chameleons were housed individually in an experimental mesh exclosure at the US Department of Agriculture (USDA), Wildlife Services, National…

Continue Reading Commonly collected thermal performance data can inform species distributions in a data-limited invader

[Bug 2240302] New: Review Request: gloo

bugzilla.redhat.com/show_bug.cgi?id=2240302 Bug ID: 2240302 Summary: Review Request: gloo – A PyTorch communication library Product: Fedora Version: rawhide OS: Linux Status: NEW Component: Package Review Severity: medium Assignee: nobody@xxxxxxxxxxxxxxxxx Reporter: trix@xxxxxxxxxx QA Contact: extras-qa@xxxxxxxxxxxxxxxxx CC: package-review@xxxxxxxxxxxxxxxxxxxxxxx Target Milestone: — Classification: Fedora Spec URL: trix.fedorapeople.org/gloo.spec SRPM URL: trix.fedorapeople.org/gloo-0.5.0%5egit20230824.01a0c81-1.fc40.src.rpm Gloo is a collective…

Continue Reading [Bug 2240302] New: Review Request: gloo

[Bug 2239184] New: Review Request: FXdiv

bugzilla.redhat.com/show_bug.cgi?id=2239184 Bug ID: 2239184 Summary: Review Request: FXdiv – A PyTorch fixed point division, math header Product: Fedora Version: rawhide OS: Linux Status: NEW Component: Package Review Severity: medium Assignee: nobody@xxxxxxxxxxxxxxxxx Reporter: trix@xxxxxxxxxx QA Contact: extras-qa@xxxxxxxxxxxxxxxxx CC: package-review@xxxxxxxxxxxxxxxxxxxxxxx Target Milestone: — Classification: Fedora Spec URL: trix.fedorapeople.org/FXdiv.spec SRPM URL: trix.fedorapeople.org/FXdiv-1.0%5egit20201208.63058ef-1.fc40.src.rpm Header-only…

Continue Reading [Bug 2239184] New: Review Request: FXdiv

The Rise of Human iPSC Banks as a Means of Making iPS Cells Widely Available

The high cost of producing and validating induced pluripotent stem cells (iPSCs or iPS cells) makes them inaccessible for many researchers. This has necessitated the creation of cell banks that can provide high-quality iPSCs to researchers who would otherwise be unable to produce and characterize these cells within their own…

Continue Reading The Rise of Human iPSC Banks as a Means of Making iPS Cells Widely Available

Providence Jobs – Manager – Bioinformatics Clinical Genomics in Portland, Oregon, United States

Description The Manager – Bioinformatics Clinical Genomics is responsible for delivery and oversight of clinical genomics interpretation and reporting software systems, and for day-to-day technical and operational supervision of a team of software engineers and bioinformatics scientists supporting clinical genomics. The Manager – Bioinformatics Clinical Genomics will lead the implementation…

Continue Reading Providence Jobs – Manager – Bioinformatics Clinical Genomics in Portland, Oregon, United States

Legal and Regulatory Manager at Phase3 Telecom Limited

Job Filter Field Role Industry Discipline Keyword Job Field: Administration / Secretarial / Personal Assistant (PA) / Clerical / Office AssistantAdvertising / Branding / Public Relation (PR) Agriculture / Agro-Allied / Farming Architectural / Designing / SurveyingArtisan…

Continue Reading Legal and Regulatory Manager at Phase3 Telecom Limited

hypothetical protein LOTGIDRAFT_112989, maker-scaffold299_size217019-snap-gene-1.29 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of hypothetical protein LOTGIDRAFT_112989 vs. L. salmonis genes Match: EMLSAG00000011196 (supercontig:LSalAtl2s:LSalAtl2s761:366436:368626:1 gene:EMLSAG00000011196 transcript:EMLSAT00000011196 description:”maker-LSalAtl2s761-augustus-gene-2.9″) HSP 1 Score: 208.764 bits (530), Expect = 1.424e-65Identity = 100/171 (58.48%), Postives = 126/171 (73.68%), Query Frame = 0 Query: 120 NPIVFFDITIGGDPVGRIVMELYANVVPKTVDNFRALCTGEKGQVGGSGIPLHYKNSSFHRVINRFMLQGGDFTAGDGTGGASIYGEKFADENFLLKHEKPGLLSMANAGPGTNGSQFFLTTVNCPHLDGKHVVFGRAIKGMGIVNEIEVMETT-SDKPNVEVKIADCGQI 289 NP+VFFDI +G +GRIVMEL+A+V PKT +NFR CTGE…

Continue Reading hypothetical protein LOTGIDRAFT_112989, maker-scaffold299_size217019-snap-gene-1.29 (gene) Tigriopus kingsejongensis

[Bug 2238217] New: Review Request: FP16

bugzilla.redhat.com/show_bug.cgi?id=2238217 Bug ID: 2238217 Summary: Review Request: FP16 – A PyTorch half-precision floating point type dependency Product: Fedora Version: rawhide OS: Linux Status: NEW Component: Package Review Severity: medium Assignee: nobody@xxxxxxxxxxxxxxxxx Reporter: trix@xxxxxxxxxx QA Contact: extras-qa@xxxxxxxxxxxxxxxxx CC: package-review@xxxxxxxxxxxxxxxxxxxxxxx Target Milestone: — Classification: Fedora Spec URL: trix.fedorapeople.org/FP16.spec SRPM URL: trix.fedorapeople.org/FP16-1.0%5egit20210317.0a92994-1.fc40.src.rpm FAS:…

Continue Reading [Bug 2238217] New: Review Request: FP16

Top 25 Bioconductor Interview Questions and Answers

Bioconductor is an open-source software project that provides tools for the analysis and comprehension of high-throughput genomic data. It’s a powerful tool, widely used in bioinformatics and computational biology to process and analyze intricate biological data. Bioconductor’s strength lies in its vast array of packages specifically tailored for genomics research,…

Continue Reading Top 25 Bioconductor Interview Questions and Answers

Three Ways AI Can Transform Software Engineering

Bobbi is SVP, Software Engineering at Loopio. She is a technology leader with over 25 years of diverse experience in the industry. getty AI and emerging technologies under the AI umbrella—like generative pre-trained transformers (GPT)—are reshaping the business world. These technologies are fostering greater organizational efficiencies and innovations and are…

Continue Reading Three Ways AI Can Transform Software Engineering

AI Software Solutions Engineer at Intel

Job Description Intel Datacenter and AI Group focuses on developing disruptive solutions that will shape the future of AI and Deep Learning computing. Led by top technologists and successful entrepreneurs, our vision is to take AI processing from its current limits to the peak of its potential. We see challenges…

Continue Reading AI Software Solutions Engineer at Intel

Illumina hiring Bioinformatics Software Development in Great Abington, England, United Kingdom

What if the work you did every day could impact the lives of people you know? Or all of humanity?At Illumina, we are expanding access to genomic technology to realize health equity for billions of people around the world. Our efforts enable life-changing discoveries that are transforming human health through…

Continue Reading Illumina hiring Bioinformatics Software Development in Great Abington, England, United Kingdom

Children’s Hospital of Philadelphia hiring Bioinformatics Scientist I – Oldridge Lab in Philadelphia, PA

SHIFT:Any (United States of America)Seeking Breakthrough MakersChildren’s Hospital of Philadelphia (CHOP) offers countless ways to change lives. Our diverse community of more than 20,000 Breakthrough Makers will inspire you to pursue passions, develop expertise, and drive innovation.At CHOP, your experience is valued; your voice is heard; and your contributions make…

Continue Reading Children’s Hospital of Philadelphia hiring Bioinformatics Scientist I – Oldridge Lab in Philadelphia, PA

Research reveals how the brain sets your body’s dinner clock

SCN snRNA-seq reveals minimal alteration of circadian genes during SF. Credit: Science Advances (2023). DOI: 10.1126/sciadv.adh9570 When you eat is just as important as what you eat. Many people consume their biggest meal of the day at dinner, when it’s after dark and they’re unwinding. But science has shown that…

Continue Reading Research reveals how the brain sets your body’s dinner clock

google cloud vertex ai – Json file based Question and answering model using VertexAI

I’m working on document based question and answering model using vertexAI.. But here I’m using Json file instead of document such as PDF or DOCS. Consider that, the 1000s of json file which contains the specific customer information. So I need to use with vertexAI. I have already referred the…

Continue Reading google cloud vertex ai – Json file based Question and answering model using VertexAI

Looking for a Job in Croatia? This Week’s Top 10 from Posao.hr (August 27, 2023)

August 27, 2023 – Looking for a job in Croatia? A weekly feature on TCN, in partnership with leading job site agency, Posao.hr, who present a selection of weekly job listings. How hard is it to find a job in Croatia, and what is on offer? We spoke to Ines…

Continue Reading Looking for a Job in Croatia? This Week’s Top 10 from Posao.hr (August 27, 2023)

Building an Enterprise-Grade Gen AI App Using Google Vertex AI and SingleStoreDB

4. (Optional Step) Fine tune/customize the models based on a couple of custom use cases. We will cover this in greater detail in a future blog/webinar. 5. Write your app in Google Collab or within SingleStore Notebook  The code snippets below will show you how to use LangChain to scrape…

Continue Reading Building an Enterprise-Grade Gen AI App Using Google Vertex AI and SingleStoreDB

Bug#1050436: upower: autopkgtest regression on i386: excessive precision?

Source: upower 1.90.2-4 Severity: serious Tags: sid trixie X-Debbugs-CC: bu…@debian.org User: debi…@lists.debian.org Usertags: regression Control: affects -1 src:libgudev Dear maintainer(s), With a recent upload of upower, the autopkgtest of upower fails on i386 in testing when that autopkgtest is run with the binary packages of upower and libgudev from unstable….

Continue Reading Bug#1050436: upower: autopkgtest regression on i386: excessive precision?

Bioinformatic Scientist | Hire Veterans

Full-Time Administration Defense Government Human Resources Manufacturing QA-Quality Control Research Science Overview We are seeking a Bioinformatic Scientist to support the National Institutes of Health’s National Institute of Allergy and Infectious Diseases (NIAID) in Bethesda, MD. Our NIAID professional, technical, and scientific support personnel are part of a team focused…

Continue Reading Bioinformatic Scientist | Hire Veterans

Robust deep learning-based PET prognostic imaging biomarker for DLBCL patients: a multicenter study

Li S, Young KH, Medeiros LJ. Diffuse large B-cell lymphoma. Pathology. 2018;50(1):74–87. Article  PubMed  Google Scholar  Vodicka P, Klener P, Trneny M. Diffuse large B-cell lymphoma (DLBCL): early patient management and emerging treatment options. Onco Targets Ther. 2022;6(15):1481–501. Article  Google Scholar  Poletto S, Novo M, Paruzzo L, Frascione PMM, Vitolo…

Continue Reading Robust deep learning-based PET prognostic imaging biomarker for DLBCL patients: a multicenter study

[Solved] If possible, I would much appreciate an explanation using RStudio!….

<p>sectetur adipis</p><figure class=”table”><table><tbody><tr><td><p style=”margin-left:0in;”>sectetur adipisc</p></td><td><p style=”margin-left:0in;”>sectetur adipi</p></td><td><p style=”margin-left:0in;”>sectetur adipis</p></td><td><p style=”margin-left:0in;”>secte</p></td></tr><tr><td><p style=”margin-left:0in;”>sec</p></td><td><p style=”margin-left:0in;”><strong>sectetu</strong></p></td><td><p style=”margin-left:0in;”><strong>sectetu</strong></p></td><td><p style=”margin-left:0in;”>sec</p></td></tr><tr><td><p style=”margin-left:0in;”>sect</p></td><td><p style=”margin-left:0in;”><strong>sectet</strong></p></td><td><p style=”margin-left:0in;”><strong>sectet</strong></p></td><td><p style=”margin-left:0in;”>sec</p></td></tr><tr><td><p style=”margin-left:0in;”>secte</p></td><td><p style=”margin-left:0in;”><strong>sectet</strong></p></td><td><p style=”margin-left:0in;”><strong>sectet</strong></p></td><td><p style=”margin-left:0in;”>se</p></td></tr><tr><td><p style=”margin-left:0in;”>sectetur a</p></td><td><p style=”margin-left:0in;”><strong>sectet</strong></p></td><td><p style=”margin-left:0in;”><strong>sectet</strong></p></td><td><p style=”margin-left:0in;”>se</p></td></tr><tr><td><p style=”margin-left:0in;”>secte</p></td><td><p style=”margin-left:0in;”>sec</p></td><td><p style=”margin-left:0in;”>sec</p></td><td><p style=”margin-left:0in;”>sec</p></td></tr></tbody></table></figure><p> </p><p>sectetur adipi</p><p style=”margin-left:0in;”>se<sup>s</sup>sectetur</p><p style=”margin-left:0in;”> </p><p style=”margin-left:0in;”>sectetur adipi</p><p style=”margin-left:0in;”>se<sup>s</sup><sub>sect</sub>sectetur</p><p style=”margin-left:0in;”> </p><p style=”margin-left:0in;”>sectetur adipisc</p><p style=”margin-left:0in;”>sectetur adipiscing elit. Nam lacinia pulvinar tortor nec facilisis. Pellentesque…

Continue Reading [Solved] If possible, I would much appreciate an explanation using RStudio!….

Looking for a Job in Croatia? This Week’s Top 10 from Posao.hr (August 20, 2023)

August 20, 2023 – Looking for a job in Croatia? A weekly feature on TCN, in partnership with leading job site agency, Posao.hr, who present a selection of weekly job listings. How hard is it to find a job in Croatia, and what is on offer? We spoke to Ines…

Continue Reading Looking for a Job in Croatia? This Week’s Top 10 from Posao.hr (August 20, 2023)

Bug#1050060: src:pd-iemmatrix: fails to migrate to testing for too long: autopkgtest regression on i386

Source: pd-iemmatrix Version: 0.3.2-4 Severity: serious Control: close -1 0.3.3-1 Tags: sid trixie User: release.d…@packages.debian.org Usertags: out-of-sync Dear maintainer(s), The Release Team considers packages that are out-of-sync between testing and unstable for more than 30 days as having a Release Critical bug in testing [1]. Your package src:pd-iemmatrix has been…

Continue Reading Bug#1050060: src:pd-iemmatrix: fails to migrate to testing for too long: autopkgtest regression on i386

Bioinformatics jobs – Biodesign Jobs

Filters Filter Category All categoriesDesignEngineeringFinanceHuman ResourcesMarketingOperationsProduct ManagementQuality Assurance (QA)ResearchSales Job Type All job typesFull-timeContractPart-timeInternship Posted At Any timeLast 24 hoursLast 3 daysLast 7 daysLast 14 daysLast 30 days Location Radius Exact location only within 5 miles within 10 miles within 15 miles within 25 miles within 50 miles within 100…

Continue Reading Bioinformatics jobs – Biodesign Jobs

Fails to build binary packages again after successful build

Source: lammps Version: 20220106.git7586adbb6a+ds1-2 Severity: minor Tags: trixie sid ftbfs User: lu…@debian.org Usertags: ftbfs-binary-20230816 ftbfs-binary-after-build User: debi…@lists.debian.org Usertags: qa-doublebuild Hi, This package fails to do build a binary-only build (not source) after a successful build (dpkg-buildpackage ; dpkg-buildpackage -b). This is probably a clear violation of Debian Policy section 4.9 (clean…

Continue Reading Fails to build binary packages again after successful build

Columbia University Irving Medical Center hiring Bioinformatics Programmer in New York, New York, United States

Grade 105 Job Type: Officer of Administration Bargaining Unit: Regular/Temporary: Regular End Date if Temporary: Hours Per Week: 35 Standard Work Schedule: M-F 9am – 5pm Building: Salary Range: $80,000 – $100,000 The salary of the finalist selected for this role will be set based on a variety of factors,…

Continue Reading Columbia University Irving Medical Center hiring Bioinformatics Programmer in New York, New York, United States

Bioinformatics Programmer – Medical Center, New York, United States

Bioinformatics Programmer Job Type: Officer of Administration Bargaining Unit: Regular/Temporary: Regular End Date if Temporary: Hours Per Week: 35 Standard Work Schedule: M-F 9am – 5pm Building: Salary Range: $80,000 – $100,000 The salary of the finalist selected for this role will be set based on a variety of factors,…

Continue Reading Bioinformatics Programmer – Medical Center, New York, United States

Biotecnika Instances E-newsletter 11.08.2023 Freshers Job Merck, Undertaking Intern, TIGS Hiring, Workshop Registrations Open + A lot Extra

Biotecnika Instances E-newsletter 11.08.2023 Freshers Job Merck, Undertaking Intern, TIGS Hiring, Workshop Registrations Open + A lot Extra Freshers Job at Merck – MSc Biotech, Biochem, Mol Bio & Microbiology Apply For Analyst Function President College Undertaking Intern With Pupil Assistantship For Life Sciences AIC-CCMB MSc Life Sciences Senior Science…

Continue Reading Biotecnika Instances E-newsletter 11.08.2023 Freshers Job Merck, Undertaking Intern, TIGS Hiring, Workshop Registrations Open + A lot Extra

Biotecnika Times Newsletter 11.08.2023 Freshers Job Merck, Project Intern, TIGS Hiring, Workshop Registrations Open + Much More

Biotecnika Times Newsletter 11.08.2023 Freshers Job Merck, Project Intern, TIGS Hiring, Workshop Registrations Open + Much More Freshers Job at Merck – MSc Biotech, Biochem, Mol Bio & Microbiology Apply For Analyst Role President University Project Intern With Student Assistantship For Life Sciences AIC-CCMB MSc Life Sciences Senior Science Communicator…

Continue Reading Biotecnika Times Newsletter 11.08.2023 Freshers Job Merck, Project Intern, TIGS Hiring, Workshop Registrations Open + Much More

[Bug 2229525] New: Review Request: golang-github-google-gnostic

bugzilla.redhat.com/show_bug.cgi?id=2229525 Bug ID: 2229525 Summary: Review Request: golang-github-google-gnostic – A compiler for APIs described by the OpenAPI Specification Product: Fedora Version: rawhide Status: NEW Component: Package Review Assignee: nobody@xxxxxxxxxxxxxxxxx Reporter: zebob.m@xxxxxxxxx QA Contact: extras-qa@xxxxxxxxxxxxxxxxx CC: package-review@xxxxxxxxxxxxxxxxxxxxxxx Target Milestone: — Classification: Fedora Spec URL: eclipseo.fedorapeople.org/for-review/golang-github-google-gnostic.spec SRPM URL: eclipseo.fedorapeople.org/for-review/golang-github-google-gnostic-0.6.9-1.fc38.src.rpm Description: A compiler…

Continue Reading [Bug 2229525] New: Review Request: golang-github-google-gnostic

Generative AI with LangChain, RStudio, and just enough Python

LangChain is one of the hottest development platforms for creating applications that use generative AI—but it’s only available for Python and JavaScript. What to do if you’re an R programmer who wants to use LangChain? Fortunately, you can do lots of useful things in LangChain with pretty basic Python code….

Continue Reading Generative AI with LangChain, RStudio, and just enough Python

Ambry Genetics hiring Bioinformatics Scientist II in United States

Compensation: $130,000-$140,000 per year. You are eligible to a Short-Term Incentive Plan with the target at 7.5% of your annual earnings, terms and conditions apply. JOB OVERVIEW: The job’s main responsibility is to collaborate with biologists, bioinformaticians, and clinicians to design, validate, and maintain bioinformatics pipelines and applications. RESPONSIBILITIES: Provide…

Continue Reading Ambry Genetics hiring Bioinformatics Scientist II in United States

MX2 Data Center (Phase 3)

Project Profile Get all the information on the MX2 Data Center (Phase 3), a ICT project. Connect with the contracted companies and their key contacts, track the project stage and milestones, read related news and more. Some issues around this topic are: Data centers. Write to us at info@bnamericas.com or…

Continue Reading MX2 Data Center (Phase 3)

This function shouldn’t be called in “inventory” builder

Source: sagemath Version: 9.5-6 Severity: important Tags: ftbfs User: python-modules-t…@lists.alioth.debian.org Usertags: sphinx7.1 Hi, sagemath fails to build with Sphinx 7.1 and docutils 0.20, both of which are currently available in experimental. Relevant part (hopefully): > make[3]: Entering directory ‘/<<PKGBUILDDIR>>’ > cd sage && SAGE_ROOT=/<<PKGBUILDDIR>>/sage > PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games:/<<PKGBUILDDIR>>/sage/build/bin > src/doc/bootstrap > mv…

Continue Reading This function shouldn’t be called in “inventory” builder

Infocusp Innovations hiring Senior Bioinformatics Scientist in Pune, Maharashtra, India

Infocusp Innovations is an IT firm working in the broad fields of Machine Learning, Artificial Intelligence (AI), Computer Science, Software Engineering, Mobile and Web App Development, QA, and Signal Processing. Headquartered in Ahmedabad and having a branch office in Pune, we make businesses smart and systems smarter to make people’s…

Continue Reading Infocusp Innovations hiring Senior Bioinformatics Scientist in Pune, Maharashtra, India

Bioinformatician/Senior Bioinformatician job with QATAR UNIVERSITY

Institution: Qatar University Health Cluster Job Description: We are seeking an experienced and driven Senior Bioinformatician to join our research team at the Qatar University Health Cluster. The successful candidate will be responsible for leading, designing, and implementing bioinformatics and biostatistics methodologies to support our research objectives. The position involves…

Continue Reading Bioinformatician/Senior Bioinformatician job with QATAR UNIVERSITY

Hands-On Natural Language Processing with PyTorch 1.x: Build smart, AI-driven linguistic applications using deep learning and NLP techniques 9781789802740, 1789802741

File loading please wait… Citation preview Hands-On Natural Language Processing with PyTorch 1.x Build smart, AI-driven linguistic applications using deep learning and NLP techniques Thomas Dop BIRMINGHAM—MUMBAI Hands-On Natural Language Processing with PyTorch 1.x Copyright © 2020 Packt Publishing All rights reserved. No part of this book may be reproduced,…

Continue Reading Hands-On Natural Language Processing with PyTorch 1.x: Build smart, AI-driven linguistic applications using deep learning and NLP techniques 9781789802740, 1789802741

Bioinformatics Engineer – Hiring Urgently at Labcorp in Indianapolis, IN

We are in need of a competitive Bioinformatics Engineer to join our inspiring team at LabCorp in Indianapolis, IN.Growing your career as a Full Time Bioinformatics Engineer is an unparalleled opportunity to develop excellent skills.If you are strong in research, decision-making and have the right mindset for the job, then…

Continue Reading Bioinformatics Engineer – Hiring Urgently at Labcorp in Indianapolis, IN

python – Old pytorch version on new gpu

I am trying to setup a project from github. It is based on python 3.8 and pytorch 1.6. The gpu I am using is NVIDIA GeForce RTX 3080 Ti GPU with Driver Version: 535.54.03 and CUDA Version: 12.2 according to nvidia-smi. (Using torch 13.1 torch.version.cuda shows 11.7. I could run…

Continue Reading python – Old pytorch version on new gpu

Generative AI – Google Vertex AI – For QA Engineers

This introductory course is designed specifically for Software Quality Engineers interested in leveraging the power of Generative AI to enhance their testing, automation, and productivity. Throughout the course, participants will learn how to apply Generative AI techniques to automate the generation of test cases, simulate user behavior, create user stories,…

Continue Reading Generative AI – Google Vertex AI – For QA Engineers

is a bioinformatics certificate worth it

Application criteria may vary depending on the program you wish to be admitted to. Microbiology Course. Hello all, I have a BS in molecular biology, and after working for a bit and dipping my feet in the wet lab, I realize it is not the place I want to be….

Continue Reading is a bioinformatics certificate worth it

Bug#1040964: src:slixmpp: fails to migrate to testing for too long: autopkgtest regression

Source: slixmpp Version: 1.8.3-1 Severity: serious Control: close -1 1.8.4-2 Tags: sid trixie User: release.debian….@packages.debian.org Usertags: out-of-sync Control: block -1 by 1040057 Dear maintainer(s), The Release Team considers packages that are out-of-sync between testing and unstable for more than 30 days as having a Release Critical bug in testing [1]….

Continue Reading Bug#1040964: src:slixmpp: fails to migrate to testing for too long: autopkgtest regression

Generative Ai – Google Vertex Ai

www.udemy.com/course/generative-ai-google-vertex-ai-for-qa-engineers/ Google Vertex AI , Boost Efficiency, AI Automation, AI Helper, AI Data, Generative AI   This introductory course is designed specifically for Software Quality Engineers interested in leveraging the power of Generative AI to enhance their testing, automation, and productivity. Throughout the course, participants will learn how to apply…

Continue Reading Generative Ai – Google Vertex Ai

[FREE] Generative Ai – Google Vertex Ai

Download Generative Ai – Google Vertex Ai – For Qa Engineers in one single click, On our website, you will find free many premium assets like Free Courses, Photoshop Mockups, Lightroom Preset, Photoshop Actions, Brushes & Gradient, Videohive After Effect Templates, Fonts, Luts, Sounds, 3d models, Plugins, and much more. Psdly.com

Continue Reading [FREE] Generative Ai – Google Vertex Ai

Stem Cell Manufacturing Market to Perceive Prominent Growth of USD 21.57 billion, grow at a 9.4% CAGR by 2029

PRESS RELEASE Published July 12, 2023 As part of the final report, an analysis will be included to examine the effects of the Russia-Ukraine War and COVID-19 on the Stem Cell Manufacturing industry.                       Stem Cell Manufacturing What Is A…

Continue Reading Stem Cell Manufacturing Market to Perceive Prominent Growth of USD 21.57 billion, grow at a 9.4% CAGR by 2029

Assistant / Associate Professor of Chemistry / Specialty, Biochemistry job with QATAR UNIVERSITY

Organization Name Chemistry and Earth Sciences College/Department Profile Qatar University Profile: Qatar University is the national institution of higher education in Qatar. It provides high quality undergraduate and graduate programs that prepare competent graduates, destined to shape the future of Qatar. The university community has diverse and committed faculty that…

Continue Reading Assistant / Associate Professor of Chemistry / Specialty, Biochemistry job with QATAR UNIVERSITY

Bug#1040053: gjs: autopkgtest regression: free(): invalid pointer

Source: gjs Version: 1.74.3-1 Severity: serious User: debi…@lists.debian.org Usertags: regression Dear maintainer(s), With a recent upload of gjs the autopkgtest of gjs fails in testing when that autopkgtest is run with the binary packages of gjs from unstable. It passes when run with only packages from testing. In tabular form: …

Continue Reading Bug#1040053: gjs: autopkgtest regression: free(): invalid pointer

Artificial Intelligence Companies Pushing the Boundaries of AI Innovation in 2023

AI rapidly transforms how people live, work, and interact with technology. Its impact is being felt across various industries, such as healthcare, finance, transportation, and retail. This 2023, certain artificial intelligence companies are leading the charge in developing groundbreaking AI technologies and applications and being at the forefront of this…

Continue Reading Artificial Intelligence Companies Pushing the Boundaries of AI Innovation in 2023

371 tests failed, up to 200 failures are tolerated

Source: sympy, sagemath Control: found -1 sympy/1.12-2 Control: found -1 sagemath/9.5-6 Severity: serious Tags: sid bookworm User: debian…@lists.debian.org Usertags: breaks needs-update Dear maintainer(s), With a recent upload of sympy the autopkgtest of sagemath fails in testing when that autopkgtest is run with the binary packages of sympy from unstable. It…

Continue Reading 371 tests failed, up to 200 failures are tolerated

AMD Officially Bringing ROCm Support To RDNA 3 GPUs This Fall, Starting With Radeon RX 7900 XTX & Pro W7900

AMD has officially announced ROCm support for consumer Radeon “RDNA 3” GPUs such as the RX 7900 XTX & Pro W7900 coming this fall. AMD ROCm Officially Gets Consumer Radeon “RDNA 3” GPU Support This Fall A few weeks back, we reported that AMD had plans to bring ROCm support…

Continue Reading AMD Officially Bringing ROCm Support To RDNA 3 GPUs This Fall, Starting With Radeon RX 7900 XTX & Pro W7900

Bug#1039918: node-chart.js: autopkgtest regression: Testing chartjs-plugin-annotation: NOT FOUND

Source: node-chart.js Version: 3.9.1+~cs3.1.2-2 Severity: serious User: debian…@lists.debian.org Usertags: regression Dear maintainer(s), With a recent upload of node-chart.js the autopkgtest of node-chart.js fails in testing when that autopkgtest is run with the binary packages of node-chart.js from unstable. It passes when run with only packages from testing. In tabular form:…

Continue Reading Bug#1039918: node-chart.js: autopkgtest regression: Testing chartjs-plugin-annotation: NOT FOUND

Bug#1039920: ruby-browser: autopkgtest regression: No such file or directory @ rb_sysopen

Source: ruby-browser Version: 5.3.1-2 Severity: serious User: debian…@lists.debian.org Usertags: regression Dear maintainer(s), With a recent upload of ruby-browser the autopkgtest of ruby-browser fails in testing when that autopkgtest is run with the binary packages of ruby-browser from unstable. It passes when run with only packages from testing. In tabular form:…

Continue Reading Bug#1039920: ruby-browser: autopkgtest regression: No such file or directory @ rb_sysopen

Why Your OpenAPI Spec Sucks

A mix of anticipation and dread washes over me as I open a new inbound email with an attached specification file. With a heavy sigh, I begin scrolling through its contents, only to be greeted by disappointment yet again. The API request bodies lack essential details: the actual properties of…

Continue Reading Why Your OpenAPI Spec Sucks

Debian Security Update for pytorch (CVE-2022-45907)

QID 183008: Debian Security Update for pytorch (CVE-2022-45907) QID 183008: Debian Security Update for pytorch (CVE-2022-45907) Debian has released a security update for pytorch to fix the vulnerabilities. Successful exploitation of this vulnerability could lead to a security breach or could affect integrity, availability, and confidentiality. CVSS V3 rated as…

Continue Reading Debian Security Update for pytorch (CVE-2022-45907)

QA Specialist (Bioinformatics) _ FTE/W2 – TAJ Technologies, Inc.

We at TAJ take pride in serving Fortune 500 clients and Federal and State Government in IT related projects. Our 34 years in business has earned us great industry recognitions, provides a stable environment and challenging project opportunities for its consultants.   Title: QA Specialist (Bioinformatics) Location: Bethesda, MD (Onsite…

Continue Reading QA Specialist (Bioinformatics) _ FTE/W2 – TAJ Technologies, Inc.

Baylor Genetics Analytical Software QA Engineer – Bioinformatics

JSUMMARY: Analytical Software QA engineer responsible for designing, developing, evaluating, maintaining, optimizing, and ensuring the quality of internally developed data analytical software tools, digital platforms, as well as externally acquired software systems. QUALIFICATIONS: Education: Bachelor’s Degree or higher degree in Computer Science, Computer Engineering, Bioinformatics, or science degree and/with two…

Continue Reading Baylor Genetics Analytical Software QA Engineer – Bioinformatics

Exact Sciences hiring Senior Bioinformatics Product Owner in United States

Position OverviewThe Senior Bioinformatics Product Owner is to work and technically lead in a highly dynamic environment, engaging and coordinating the activities with internal stakeholders, collaborators, software developers, contractors, and third-party vendors for the flawless development of critical bioinformatics products and its implementation for a Genomics CLIA laboratory and FDA…

Continue Reading Exact Sciences hiring Senior Bioinformatics Product Owner in United States

Bug#1038124: src:geoalchemy2: fails to migrate to testing for too long: autopkgtest regression

Source: geoalchemy2 Version: 0.12.5-1 Severity: serious Control: close -1 0.13.3-1 Tags: sid trixie User: release.debian….@packages.debian.org Usertags: out-of-sync Control: block -1 by 1034304 Dear maintainer(s), The Release Team considers packages that are out-of-sync between testing and unstable for more than 30 days as having a Release Critical bug in testing [1]….

Continue Reading Bug#1038124: src:geoalchemy2: fails to migrate to testing for too long: autopkgtest regression