Tag: query

Hello LAMMPS users, I am using windows 30 july 2021. units are real. I have a query regarding rigid command. I want to move graphene as a rigid body. For this I have created two groups. One group is fixedatoms (purple colored) and the second group is rigidcarbonatoms (grey color)….

How to convert transcript-relative coordinates to genomic coordinates? 0 I have queried using Entrez Utilities (efetch: www.ncbi.nlm.nih.gov/books/NBK25499/) and obtained annotations for transcripts like the following: >Feature ref|NM_152486.3| 1 2557 gene gene SAMD11 gene_syn MRS gene_desc sterile alpha motif domain containing 11 db_xref GeneID:148398 db_xref HGNC:HGNC:28706 db_xref MIM:616765 How/what database should…

I recently had a script fail due to poor handling of BLAST output. The BLAST -outfmt staxids field usually returns a single taxid, but occasionally it returns two or more taxids separated by a semicolon, such as 556514;701533. Fixing the script to handle this should be fairly straightforward. But the…

Hardware Pre-requisite Jetson Nano A 5V 4Ampere Charger 64GB SD card Software Preparing Your Raspberry Pi Flashing Jetson SD Card Image Unzip the SD card image Insert SD card into your system. Bring up Etcher tool and select the target SD card to which you want to flash the image….

Using NCBI Entrez direct. $ esearch -db assembly -query “GCA_000005845” | elink -target taxonomy | efetch -format native -mode xml | grep ScientificName | awk -F “>|<” ‘BEGIN{ORS=”, “;}{print $3;}’ Escherichia coli str. K-12 substr. MG1655, cellular organisms, Bacteria, Proteobacteria, Gammaproteobacteria, Enterobacterales, Enterobacteriaceae, Escherichia, Escherichia coli, Escherichia coli K-12, If…

downloading RNA seq data 0 Hi friends I am using the following code to get the data from TCGA. I want to have only one allocate of each person then I will have unique patients ID. Is there any line of code that I should add to this to get…

DOI: 10.18129/B9.bioc.GSE13015     GEO accession data GSE13015_GPL6106 as a SummarizedExperiment Bioconductor version: Release (3.14) Microarray expression matrix platform GPL6106 and clinical data for 67 septicemic patients and made them available as GEO accession [GSE13015](https://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE13015). GSE13015 data have been parsed into a SummarizedExperiment object available in ExperimentHub. This data data…

The program align.py uses mappy to align reads in Python using multiple worker threads. After loading the index the memory usage jumps up quickly to >20Gb and then continues to climb steadily through 40Gb an beyond. This issue was first discovered in bonito and isolated to mappy. The data flow…

Hi Guys, When I am trying to run bwa mem on multiple processor, I am getting error as : > mpirun -np 16 bwa mem hg19-agilent.fasta R1.fastq R2.fastq | samtools sort -o aln.bam [M::bwa_idx_load_from_disk] read 0 ALT contigs [M::bwa_idx_load_from_disk] read 0 ALT contigs [M::bwa_idx_load_from_disk] read 0 ALT contigs [M::bwa_idx_load_from_disk] read…

If you’ve tried OpenAPI spec generators, you know how it goes. They get you about 60-80% there, but you end up having to modify the code by hand. For one of the specs (GitHub REST API spec), a popular code generator I tried produced more than 300 compile-time errors. With…

Describe the issue VEP give errors even my query and reference has same assembly version Command :$: ./vep -i examples/homo_sapiens_GRCh37.vcf –cache –refseq cache reference details while running install.pl ? 458 NB: Remember to use –refseq when running the VEP with this cache! downloading ftp.ensembl.org/pub/release-104/variation/indexed_vep_cache/homo_sapiens_refseq_vep_104_GRCh37.tar.gz unpacking homo_sapiens_refseq_vep_104_GRCh37.tar.gz converting cache, this may…

In bioinformatics, BLAST (Basic Local Alignment Search Tool) is an algorithm for comparing primary biological sequence information, such as the amino-acid sequences of different proteins or the nucleotides of DNA sequences. A BLAST search enables a researcher to compare a query sequence with a library or database of sequences, and…

I have a set of 100 amino acid sequences and I want to perform a BLASTP sesrch against the refseq_protein database. Accordingly I had set up the standalone version of BLAST (Version 2.11.0+) and downloaded the refseq_protein database from NCBI using the following code wget ftp.ncbi.nlm.nih.gov/refseq/release/complete/*.faa.gz The database gets downloaded…

sra toolkit 1 hello I cannot download sra files. I tried prefetch SRR17055838 and gives this error 2021-12-26T13:48:20 prefetch.2.11.2 err: error unexpected while resolving query within virtual file system module – failed to resolve accession ‘SRR17055838’ – The object is not available from your location. ( 406 ) 2021-12-26T13:48:20 prefetch.2.11.2:…

One of the biggest challenges of this decade is solving uncertainty, ethical and explainable problems in the thousands of machine learning models we interact with daily. Meta, formerly Facebook, announced the release of their supplement to aid this developing sphere. Bean Machine, Meta’s probabilistic programming system, is a PyTorch-based model…

You’re not using the pattern suggested by the RSQLite documentation. That documentation uses dbWriteTable to copy a data frame into a SQLite table: dbWriteTable(con, “mtcars”, mtcars) According to this documentation, your full code would look something like this: con <- dbConnect(RSQLite::SQLite(), “./mtcars.db”) data(mtcars) dbWriteTable(con, “mtcars”, mtcars) dbListTables(con) # Fetch all…

Galaxy-GSA – Galaxy Community Hub ← Platform Directory comments Gene Set Analysis (GSA) can be defined as the comparison of a query gene set (a list or a rank of differentially expressed genes, for example) to a reference database of annotated gene sets, in order to interpret the initial query…

Delightful code generation for OpenAPI specs for Swift written in Swift. Fast: processes specs with 100K lines of YAML in less than a second Smart: generates Swift code that looks like it’s written by hand Reliable: tested on 500K lines of publically available OpenAPI specs producing correct code every time…

Parsing the data from the Automation Hub API can sometimes prove to be challenging, especially if you are consolidating a very complex report. In this page, we are presenting a couple of tips and tricks that can be used to improve the overall data parsing process. The page contains: The…

Certain, it’s good when I’ve an image of some object, and a neural community can inform me what sort of object that’s. Extra realistically, there is perhaps a number of salient objects in that image, and it tells me what they’re, and the place they’re. The latter process (referred to…

I’m getting an error trying to to use blast v2.12 against a local nt database. I’ve downloaded nt twice from the ftp server thinking the first time it was corrupt but that didn’t change anything. My command is: blastn -db nt -num_threads 8 -outfmt “6 qseqid sacc stitle ssciname nident…

Unformatted text preview: SWI-Prolog as a Semantic Web Tool for semantic querying in Bioclipse: Integration and performance benchmarking Samuel Lampa June 2, 2010 Abstract The huge amounts of data produced in new high-throughput techniques in the life sciences, and the need for integration of heterogeneous data from disparate sources in…

  Postdoctoral Position in Structural Bioinformatics Department of Health and Human Services National Institutes of Health National Institute of Allergy and Infectious Diseases The Structural Bioinformatics Core Section (SBIS) at the National Institute of Allergy and Infectious Diseases (NIAID), Vaccine Research Center (VRC), located on the main National Institutes of…

I downloaded DataSpell, configured Jupyter Notebook (works) and connected to the database which I’m using (works). Is there any way now how I can directly refer to chosen tables in the database (via DataSpell environment) or do I still need to write whole connection code inside Jupyter Notebook? E. g….

STICR lentiviral library preparation and validation We synthesized a high-complexity lentivirus barcode library that encodes approximately 60–70 million distinct oligonucleotide RNA sequences (STICR barcodes). STICR barcodes comprised three distinct oligonucleotide fragments cloned sequentially into a multicloning site within the 3′ UTR of an enhanced green fluorescent protein (eGFP) transgene under…

M_F: May i search the sequences on ncbi for example correponding to v4 domain No, NCBI probably would not have such sequences in an easily indexed form but I could be wrong. Rather, grab some reference sequences (can be a random subsample, do not need all of them) and use…

Standard name KINNEY_DNMT1_METHYLATION_TARGETS Systematic name M2508 Brief description Hypomethylated genes in prostate tissue from mice carrying hypomorphic alleles of DNMT1 [GeneID=1786]. Full description or abstract Previous studies have shown that tumor progression in the transgenic adenocarcinoma of mouse prostate (TRAMP) model is characterized by global DNA hypomethylation initiated during early-stage…

We wish you a good luck and have a prosperous career. Working at Labcorp | Jobs and Careers at Labcorp 15 GNeuS Postdoc Positions in Neutron Science of 24 Months Each (Full-time Job) FZJ – Forschungszentrum Jülich. What other similar jobs are there to Laboratory jobs in Germany? Clinical Laboratory…

Phylogenetics is an analytical tool that quickly analyzes genomic data to provide invaluable insights into the evolution and spread of a pathogen, thereby allowing public health officials and governments to respond to it in a timely fashion. During the coronavirus disease 2019 (COVID-19) pandemic, phylogenetics, like many other pre-pandemic tools,…

Blast command line pipeline not working 0 Hello, I am running now a local blast pipeline using MacOs. The goal here is to take interval of the 5 best hits and then extract the SNP variants from multiple vcf.gz files. But I am facing an error which I cannot solve….

Easy Swagger UI for your Flask API Flasgger is a Flask extension to extract OpenAPI-Specification from all Flask views registered in your API. Flasgger also comes with SwaggerUI embedded so you can access localhost:5000/apidocs and visualize and interact with your API resources. Flasgger also provides validation of the incoming data,…

Piranha Peak-Calling with multiple replicates 0 I am trying to call RNA-Protein interation peaks by using Piranha software. I have multiple replicates for each experiment and the control data, and I can’t seem to understand how to combine them into one Piranha query. For example, if I was to call…

A result set from a PDO query is as follows… Array ( [0] => Array ( [activity_link_type] => Category [data_id] => 1 ) [1] => Array ( [activity_link_type] => Category [data_id] => 38 ) [2] => Array ( [activity_link_type] => PData [data_id] => 108 ) [3] => Array ( [activity_link_type]…

I’ve tried using the standard alphafold2 setup via docker (converted to a singularity container) via the setup described at github.com/kalininalab/alphafold_non_docker, and both result in the following error: […] E1210 12:01:01.009660 22603932526400 hhblits.py:141] – 11:49:18.512 INFO: Iteration 1 E1210 12:01:01.009703 22603932526400 hhblits.py:141] – 11:49:19.070 INFO: Prefiltering database E1210 12:01:01.009746 22603932526400 hhblits.py:141]…

The Single Nucleotide Polymorphism Database (dbSNP) is a free public archive for genetic variation within and across different species developed and hosted by the National Center for Biotechnology Information (NCBI) in collaboration with the National Human Genome Research Institute (NHGRI). Furthermore, are there any databases for single nucleotide polymorphisms?As there…

KUALA LUMPUR (Dec 9): Malaysian Genomics Resource Centre Bhd’s (MGRC) share price hit limit down on Thursday (Dec 9, 2021) after the health technology company’s stock price fell as much as 35 sen or 29.91% to 82 sen. At 82 sen, MGRC’s share price is at its lowest in about…

Say I have a vector of strings, g<-c(“bunchofstuff>query=true/fun/weird>bunchofstuff”, “bunchofstuff>query=animals/octopus/weird>bunchofstuff”, “bunchofstuff>query=flowers/sunshine/fun>bunchofstuff”, ” bunchofstuff>query=fun/true/sunshine>bunchofstuff” and I want to essentially use sub to erase anything after query=, until the end of the string, IF query= is not followed by true (ideally in any position). As far as I can tell, there isn’t a…

Hello All, I am new to the RNA-seq world and especially new to the bioinformatics side. We recently completed a RNA-seq experiment (total RNAs) on human samples and we used illumina’s Dragen RNA pipeline which generated salmon gene count (.sf) output files. In the files, the gene ID is in…

Bash script to help with print Name of reads that only have query subsequence or its verse complement and position of first occurance of this subsequence in read and output of all this in tab separat 0 Create bash script that receives name of fastq fastq file and query subsequence…

Newswise — The International Wheat Genome Sequencing Consortium (IWGSC) is pleased to announce that the bioinformatics company Curio Genomics has joined the organization as a sponsoring partner. The IWGSC is an international, collaborative consortium of wheat growers, plant scientists, and public and private breeders dedicated to the development of genomic…

I’m using RSQlite to import Datasets from an SQlite-Database. There are multiple millions of observations within the Database. Therefor I’d like to do as much as possible of Data selection and aggregation within the Database. At some point I need to aggregate a character variable. I want to get the…

Hi everyone! I have a query regarding variant calling from a high coverage site on the basis of the maximum likelihood variant. I have RNA-seq data mapped bam file. I called variant using the below command. “bcftools mpileup –max-depth 10000 -Oz -f ref.fa sample.bam | bcftools call -mv -Oz -o…

query sequence is input sequence or its reverse complement 0 >sp|O14920.1|IKKB_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase subunit beta; Short=I-kappa-B-kinase beta; Short=IKK-B; Short=IKK-beta; Short=IkBKB; AltName: Full=I-kappa-B kinase 2; Short=IKK2; AltName: Full=Nuclear factor NF-kappa-B inhibitor kinase beta; Short=NFKBIKB; AltName: Full=Serine/threonine protein kinase IKBKB MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT LAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLM LMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED QELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSI…

igBLAST query/options error 2 When I try to run this command: igblastn -germline_db_V $GERMLINE_DB”/human_gl_HV” -germline_db_J $GERMLINE_DB”/human_gl_HJ” -germline_db_D $GERMLINE_DB”/human_gl_HD” -organism human -domain_system imgt -query $WORKDIR”https://www.biostars.org/”$FILE”.fasta” -auxiliary_data $IGBLASTDIR”/optional_file/human_gl.aux” -outfmt 7 -num_threads 4 -num_alignments_V 5 -out $FILE”_tab.igblast” I get this error: BLAST query/options error: Germline annotation database human/human_V could not be found in…

Any help would be much appreciated. My goal is to run the following for loop to generate a list of sample_id (which is actually isolation site) for a list of SRAs. However I get an error (see below) for each and every SRA. for sra in `awk ‘NR>1{print $1}’ metadata.txt`…

standalone blastp: increasing word size extremely slows down the search 1 Hello, I need to blastp a genome (15,000 seqs) against genome (12,000 seqs) using Biopython. I decided to use local blast and query genome 1 fasta file against genome 2 database ( made by makeblastdb command with second genome…

I am not sure what is the proper way to carry out over-representation analysis (and also gene set enrichment analysis) for RNAseq data. Ideally, the analysis can be performed in R, otherwise, if the software/ platform can export the output file (also include all the non-statistical-significant term) will also be…

Hello all, Hope you’re well. I started a PhD in Jan this year and frankly I am struggling. I’m coming into the second week of trying to figure out how to attempt this problem and it’s honestly starting to get to me a bit – the current task I’m working…

Significance Cilia are tubulin-based cellular appendages, and their dysfunction has been linked to a variety of genetic diseases. Ciliary chondrodysplasia is one such condition that can co-occur with cystic kidney disease and other organ manifestations. We modeled skeletal ciliopathies by mutating two established disease genes in Xenopus tropicalis frogs. Bioinformatic…

How to extract genomic upstream region of a protein identified by its NCBI accession number? 1 I have a list of NCBI protein accession numbers. I would like to extract out the upstream genomic region of the corresponding gene’s nucleotide sequence. I will be thankful to you if you can…

command for isolate unique reads with unique subject id 0 So as you see below there is 1 file that contains a different column. So as some reads are multiple align to different subject id, so I want to isolate only one read which contains the highest bit score but…

BLAST Annotating Sub-sequences of Features with Not Normalized Identity Scores 1 I’m using BLAST annotation to annotate protein features using the online tool Below is a screenshot of the entered queries. Below is a screenshot of the result. My question is there is a parameter to let BLAST normalizes the…

Associated RNAi Experiments Homology BLAST of hypothetical protein DAPPUDRAFT_213302 vs. L. salmonis genes Match: EMLSAG00000000401 (supercontig:LSalAtl2s:LSalAtl2s1063:86108:87342:-1 gene:EMLSAG00000000401 transcript:EMLSAT00000000401 description:”maker-LSalAtl2s1063-snap-gene-0.46″) HSP 1 Score: 149.443 bits (376), Expect = 4.121e-44Identity = 91/196 (46.43%), Postives = 119/196 (60.71%), Query Frame = 0 Query: 14 MDKITDLQVEPLT–NSRFVKPLRLRFKQDGKVKVWDLIQCHASVAVVIFNQTTQKFVFVRQFRPAVYFSALRRAQGDVEPGTQFKGDEIDPKVGITLELCAGIVD-KSKSLIEIAHEEILEETGYDVPMNLIEEIQTFPVGVGVGGENMTLFCAEVTEAMRKGPGGGLAEEGEMIDVIEMGVEETRTLMRAKSVT 206 MDK+ VEPL +SRFV P R+ ++Q+G…

NEW YORK – The Medical University of South Carolina and Helix said Monday that they have partnered to develop a large-scale population genomics initiative in South Carolina called In Our DNA SC. Beginning this fall, the program will enroll a total of 100,000 patients, providing them with no-cost genetic testing,…

Unable to download fastq files in parallel / SOS 0 Hi! Very new to all this so bear with me if I’m using incorrect terminology. Also english is my second language. I’m trying to download my fastq files in parallel but it doesn’t work and I keep receiving this error:…

Large-scale initiative will advance innovative research, improved health outcomes CHARLESTON, S.C. and SAN MATEO, Calif., (Sept. 20, 2021) – The Medical University of South Carolina  (MUSC) and Helix have announced a strategic collaboration to develop a first-of-its-kind population genomics initiative in South Carolina called In Our DNA SC. The large-scale program is designed…

Data provision and standards. GEO sequence submission procedures are designed to encourage provision of MINSEQE elements: Thorough descriptions of the biological samples under investigation, and procedures to which they were subjected. Thorough descriptions of the protocols used to generate and process the data. Request updates to accessioned records per the…

Listing Results Kaggle training Learn Python, Data Viz, Pandas & More Tutorials Kaggle Learn Kaggle.com All Courses 8 hours agoPython Learn the most important language for data science. Intro to Machine Learning Learn the core ideas in machine learning, and build your first models. Intermediate Machine Learning Handle missing values,…

“Downtime” refers to our ability to communicate with the server. If our system can’t communicate with the server, we mark it as offline and register the time below. In most cases, the server’s failure to respond to a query is due to the server being offline, but may be due…

Dear all, I am working with a list of Ensembl accession codes for a desired group of proteins. I have downloaded the protein annotations related to the genome assembly GRCH38. I fetched the genomic coordinates from UniProtKB API service using the Ensembl accession codes. The service provide a protein annotation…

#’ Fetch AlphaFold prediction #’ #’ Fetches atom level data for AlphaFold predictions either for selected proteins or whole #’ organisms. #’ #’ @param uniprot_ids optional, a character vector of UniProt identifiers for which predictions #’ should be fetched. This argument is mutually exclusive to the code{organism_name} argument. #’ @param…

Subject:- Bioinformatics FASTA Programs and Algorithm FASTA Programs FASTA: Compares the protein sequence to another protein sequence in a database or compares nucleotide sequence to another nucleotide sequence in a database. FASTX, FASTY: It performs a search for comparing the nucleotide sequence to a protein sequence database. SSEARCH: It performs…

How to pipe awk of bed file into samtools to extract fasta sequences? 1 I have a bed file (seq.bed) that contains “queryID queryStart queryEnd”. Following is the example (the content of seq.bed file). SRR5892231.6 28 178 SRR5892231.7 4 307 SRR5892231.7 16 307 SRR5892231.9 216 408 I would like to…

public void testHavingConstraintSet() throws Exception { q1 = new Query(“select table1.field1 from table1 group by table1.field1 having (table1.field1 = table1.field2 or table1.field1 = table1.field3)”); q2 = new Query(); Table t1 = new Table(“table1”); Field f1 = new Field(“field1”, t1); Field f2 = new Field(“field2”, t1); Field f3 = new Field(“field3”,…

00:32:48.224 INFO  HaplotypeCaller – Shutting down engine [September 17, 2021 12:32:48 AM CST] org.broadinstitute.hellbender.tools.walkers.haplotypecaller.HaplotypeCaller done. Elapsed time: 0.04 minutes. Runtime.totalMemory()=2398617600 java.nio.BufferUnderflowException         at java.nio.ByteBuffer.get(ByteBuffer.java:688)         at java.nio.DirectByteBuffer.get(DirectByteBuffer.java:285)         at java.nio.ByteBuffer.get(ByteBuffer.java:715)         at htsjdk.samtools.MemoryMappedFileBuffer.readBytes(MemoryMappedFileBuffer.java:34)         at…

Introduction Antimicrobial resistance is a global issue associated with an increased and often unrestricted antibiotic use in clinical settings, which leads to the dissemination of carbapenem-resistant Enterobacterales (CRE) in healthcare facilities (World Health Organization, 2017).1 CRE constitutes a large group of bacteria with different mechanisms for drug resistance. Among them,…

Why some SNP’s are not assigned to any gene? 0 Hi everyone, I am doing polygenic risk analysis (PRS) ; As you may know PRS is done based on SNP’s. On the other hand, I would like to do some visualizations at gene level. Thus, I used rsnps library (ncbi_snp_query…

3D-Beacons Network acts as a one-stop shop for protein structures by combining and standardising data from several providers Cryo-EM structure of the BRCA1-UbcH5c/BARD1 E3-E2 module bound to a nucleosome. Image obtained from PDBe A new platform called 3D-Beacons Network brings together experimentally determined and predicted protein structure models and related…

I am having trouble running the blastp command. When I run this command against the Swiss-prot database installed from the NCBI i get this error $ blastp -db swissprot -query Ecoli_rpoB.fasta -out TEST15.txt BLAST Database error: Error: Not a valid version 4 database. However, when I create my own database…

What is currently the best user friendly (visual and interactive) VCF/BCF mining tool in 2021? For VCF/BCF similar to size or even larger than the 1000 human genomes VCF? I guess most organization do not have a visual and interactive mining VCF mining tool but use either: A website front-end…

compare two vcf files 1 Hi. I have a problem I want to compare the rs numbers in two vcf files. so I want to check which of the Rs numbers are in the top 10 percent. I don’t know what to do. Can you help me if I have…

BLAST: format specifier associated to “description” 0 I’m using blastx version 2.2.27+ and the subsequent command blastx -db nr -query fasta -outfmt ‘6 qseqid sgi sacc sseqid pident length mismatch gapopen qstart qend sstart send evalue bitscore stitle’ -evalue 1e-10 -num_alignments 1 -num_threads 24 -out blast_farm_50_20.txt that give me this…

My name is Ruddhida Vidwans, I am a Ph.D. Research Scholar at Jain University, Bengaluru, India. My research area is Forensic Microbiology. Currently, apart from my Ph.D., I am focussing on learning next-generation sequencing analysis. For that, I am practicing with the publicly available data. I am using the “GSE163207”…

Job Summary We have an exciting opportunity in our US office for an experienced bioinformatician who is interested in working at the forefront of the gene editing (CRISPR knock-out, HDR, base editing) and gene modulation (CRISPRa, CRISPRi, RNAi) fields. As a Bioinformatics Scientist 2, you will have the opportunity to…

Error in merged bam files 0 Hello I am trying to merge unmapped and mapped bam files. I merged the bam files using the picard tool (gatk.broadinstitute.org/hc/en-us/articles/360036883871-MergeBamAlignment-Picard). I checked the merged bam using ValidateSamFile command (gatk.broadinstitute.org/hc/en-us/articles/360036854731-ValidateSamFile-Picard-) and it showed the below errors: Error Type Count ERROR:MATES_ARE_SAME_END 5496 ERROR:MISMATCH_FLAG_MATE_NEG_STRAND 5478 ERROR:MISMATCH_MATE_CIGAR_STRING…

Mark duplicates the bam files sorted by coordinates 0 Hello As it is mentioned in the documentation (gatk.broadinstitute.org/hc/en-us/articles/360037224932?page=1#comment_4406762304155), it is ideal to submit the query name based sorted bam files, so will it be computationally intensive process to submit the coordinated based sorted bam files? First, I sorted the unmapped…

Explore LabKey Server’s specialized tools for assay data management below and read additional documentation on the LabKey support and documentation portal. Flow. Using SQL Search you can search for the column name and find all the stored procedures where it is used. Work faster. Finding anything in the Object Explorer….

Associated RNAi Experiments Homology BLAST of probable dimethyladenosine transferase-like vs. L. salmonis genes Match: EMLSAG00000006273 (supercontig:LSalAtl2s:LSalAtl2s341:673186:674124:1 gene:EMLSAG00000006273 transcript:EMLSAT00000006273 description:”augustus_masked-LSalAtl2s341-processed-gene-6.3″) HSP 1 Score: 484.567 bits (1246), Expect = 2.083e-174Identity = 227/310 (73.23%), Postives = 259/310 (83.55%), Query Frame = 0 Query: 9 KVRKTGSGMSTVEAAGSGGGGQQGMVFNTGLGQHILKNPLVVQSIIDKAALRSTDVVLEIGPGTGNLTVRALEKCKKLIACEVDPRMVAELQKRVQGTHFQSKLQIMVGDVIKTDLPFFDACVANVPYQISSPLVFKLLLHRPFFRCAVLMFQREFAQRLVAKPGDKLYCRLSINTQLLARVDHVMKVGKGNFRPPPKVESSVVRIEPRNPPPPINFKEWDGLTRVAFVRKNKTLGAAFNQTTVLMMLEKNYRVHLSLADEPVPEKIDIKSIIETVLAEIAFKEKRARSMDIDDFMKLLHAFNAKGIHFV 318 KV+ T + GG+QG+VFNT LGQHILKNP VV…

    This package is for version 2.11 of Bioconductor; for the stable, up-to-date release version, see rols. An R interface to the Ontology Lookup Service Bioconductor version: 2.11 This package allows to query EBI’s Ontology Lookup Service (OLS) using Simple Object Access Protocol (SOAP). Author: Laurent Gatto <lg390 at…

How to retrieved protein Fasta sequence from accession number by Entrez 1 AF131201AF326487AF326488AF326489AF326490 This are the some the accession number of protein. Firstly i dont know what kind of accession number is this. beacuse usually protein accession number start with XP_/NP_. Problem arise when i try the following command using…

Exec format error in unmapped bam file 0 Hello I created unmapped bam file from fastq file (sample 1). When I tried to search the bam file using query name, I got the ‘Exec format error’ #1_ucheck.bam: unmapped bam file from Sample 1 fastq file code: samtools view 1_ucheck.bam |…

Introduction DNA sequencing is a popular concept in both academic research and practical applications, such as gene traceability, species identification, and disease diagnosis. Whereas all industries starve for a more intelligent and efficient research method, artificial intelligence has attracted much attention, especially from the biological and medical domains. More and…

Drug/small molecule databases with SMILES and chemical properties? 0 Dear all, My lab has recently screened a library of compounds. The compounds are meant to represent chemical diversity across chemical space. We would like to supplement our experiments with in silico work. Using the pubchemy python API, I have systematically…

tabix for ID column 4 Hello, I’m looking for something similar to tabix. But instead of looking for informations within a given region, I would like to use the values in the ID column for quickly lookup. So for example I would like to take the compressed dbSNP file, index…

Listing Results Kaggle mini courses Learn Python, Data Viz, Pandas & More Tutorials Kaggle Data Kaggle.com All Courses 8 hours agoPython Learn the most important language for data science. Intro to Machine Learning Learn the core ideas in machine learning, and build your first models. Intermediate Machine Learning Handle missing…

Annotate Structural variants with population specific allele frequency values 0 Hi, Has anyone tried filtering structural variants based on pupulation specific allele frequency (AF) values (for example gnomAD-SV or phase 3 1000 genome SV)? I have a set of SVs that I detected using a multipronged approach. For prioritising variants,…

Invitae is dedicated to bringing comprehensive genetic information into mainstream medicine to improve healthcare for billions of people. Our team is driven to make a difference for the patients we serve. We are leading the transformation of the genetics industry, by making genetic testing affordable and accessible for everyone to…

Hello people, I got stucked with my new script and perhaps you can help me. Its goal is to take an input table with querys and subjects (originated by a local blast) and replace query names with subject names in the corresponding fasta file. In detail, the table input file…

I want to share with you a powerful tool named QIIME 2. It’s handy for Amplicon analysis. What is QIIME 2? The Quantitative Insights Into Microbial Ecology (QIIME) microbiome bioinformatics platform has supported many microbiome studies and gained a broad user and developer community. QIIME 2™(qiime2.org) is a new version…

Error: NCBI C++ Exception – Invalid choice selection: NCBI-Seqalign::Score.value.real 1 Hi, I am having issues running blast from command line, accessing remote databases. This is what i am running: blastn -db nt -query {input} -out {output} -evalue 0.001 -max_target_seqs 100 -remote Which returns this: Error: NCBI C++ Exception: T0 “/opt/conda/conda-bld/blast_1559335677723/work/c++/src/objects/seq/../seqalign/Score_.cpp”,…

MEME suite compare motifs between species 1 Hello, I have a set of 5kb sequences upstream of a gene from different primates, and I would like to know what motifs are in enhancers and promoters of primates vs the 5kb upstream sequences of a set of the same gene but…

The homepage is full of small visualizations telling stories about each data set. This is the default Tableau location (if you’ve not changed) so far. Transformation processes can also be referred to as data wrangling, or data munging, transforming and mapping data from one raw data form into another format…

Remote blast query limit 0 Hello! How many blast queries can be processed by remote blast calls with biopython’s Bio.Blast.NCBIWWW.qblast or BLAST+ with -remote flag? When I go above 1 sequence I get the following message near the top of my XML results file (and no results: internal_error: (Severe Error)…

Pathways that include all genes in gene_ids. Here the KEGG API operations are explained in comparison to these web tools. MODULE — modules or functional units of genes, BRITE — hierarchical classifications of biological entities, This page was last edited on 22 October 2020, at 18:43. The list can be…

Commandline BLAST – errors? 0 Hi, I’m running command line blastx and blastp against a number of databases. However, running the exact same script on the exact same input files against the exact same databases occasionally seems to output different filesizes. I can only assume that this is because the…

Global Biotechnology Market Analysis with forecast period 2020 to 2025 provides an in-depth analysis of market growth factors, future assessment, country-level analysis, Biotechnology industry distribution, and competitive landscape analysis of major industry players. The research report of global Biotechnology market report offers the extensive information about the top most makers…

Download intergenic spacers between specific genes for all findings in genbank 0 Good afternoon, I want to download fasta from genbank for intergenic spacers between certain genes for a taxon (for example, atpB-rbcL from the chloroplast genome). If I were downloading fasta for a single gene (GENE), I would do…

Google is organizing the 4th iteration of its Landmark Retrieval Challenge on Kaggle- The Google Landmark Retrieval 2021 Challenge. With the help of this completion, Google aims to leverage the Machine Learning practitioners community on Kaggle to help retrieve images that have the same landmark as that in the queried image….

The samtools view outputs information from SAM and BAM files in SAM format. You can find a description of the SAM format here: samtools.github.io/hts-specs/SAMv1.pdf Section 1.4 deals with the meaning of each of the manditory coloumns. It includes the following table: Col Field Type Regexp/Range Brief description |—|——|——-|—————————-|—————————————-| 1 QNAME…

Blast locally on multiple fasta files with multiple database 2 Hi all, I need to run blast locally on multiple fasta files contain in a directory. Previously, I have used command below: ls *.fasta | parallel -a – blastp -query {} -db my_database -evalue 0.00001 -qcov_hsp_perc 50 -outfmt 6 -max_target_seqs…