Tag: query

Real-time Analytics News for Week Ending June 10

In this week’s real-time analytics news: AWS announced access to the open-source LLM Falcon 40B and other new offerings. Keeping pace with news and developments in the real-time analytics market can be a daunting task. We want to help by providing a summary of some of the important real-time analytics…

Continue Reading Real-time Analytics News for Week Ending June 10

Accounting for 16S rRNA copy number prediction uncertainty and its implications in bacterial diversity analyses

Time-independent variation is present in 16S GCN evolution To evaluate the extent of time-independent or intraspecific variation in 16S GCN, we examined 5437 pairs of genomes with identical 16S rRNA gene alignments. The 16S GCN differs in 607 (11%) of them, suggesting the presence of significant time-independent variation. For the…

Continue Reading Accounting for 16S rRNA copy number prediction uncertainty and its implications in bacterial diversity analyses

Efflux pump gene amplifications bypass necessity of multiple target mutations for resistance against dual-targeting antibiotic

Strains and growth conditions All strains and plasmids used in this work are described in Supplementary Table 1. The clinical isolates were obtained from the Cystic Fibrosis Foundation Isolate Core at Seattle Children’s Hospital and were originally isolated from two different cystic fibrosis patients. Distribution of these isolates is covered by…

Continue Reading Efflux pump gene amplifications bypass necessity of multiple target mutations for resistance against dual-targeting antibiotic

Programming Education Market 2023 Growth Drivers and Future Outlook

” Report on the Global Programming Education Market for 2023 shows how the market is doing right now. Additionally, it denotes crucial market elements that help consumers make crucial business decisions and advance the expansion of market share. Request a sample report @ www.orbisresearch.com/contacts/request-sample/6974609 The report also hides basic product…

Continue Reading Programming Education Market 2023 Growth Drivers and Future Outlook

Neo4j unveils generative AI features for Google Cloud Vertex

Neo4j, the graph database and analytics company, announced new product integration with Google Cloud’s latest generative AI features in Vertex AI, Google’s large language model (LLM) platform. The result empowers enterprise customers to harness knowledge graphs built on Neo4j’s fully managed cloud offerings in the Google Cloud Platform for generative…

Continue Reading Neo4j unveils generative AI features for Google Cloud Vertex

Groundbreaking study sequences nearly half of primate species, yielding great insights for humans

The groundbreaking research marks a major milestone in genomic research, paving the way for further exploration and discovery across a wide range of species. A group of researchers from over 20 nations have generated the most comprehensive primate sequencing dataset to date. More than 800 genomes from 233 species around…

Continue Reading Groundbreaking study sequences nearly half of primate species, yielding great insights for humans

Contextual AI launches with $20M to build more reliable large language models for enterprises

Contextual AI Inc., an artificial intelligence development startup founded earlier this year, exited stealth mode today with $20 million in seed funding. Palo Alto, California-based Contextual AI raised the capital from a group of investors led by Bain Capital Ventures. The investment firm was joined by Lightspeed Venture Partners, Greycroft…

Continue Reading Contextual AI launches with $20M to build more reliable large language models for enterprises

Google Cloud, Mayo Clinic Collaborate to Bring Generative AI to Healthcare

Google Cloud on Wednesday announced a collaboration with Mayo Clinic to transform traditional healthcare by using generative artificial intelligence (AI). The partnership will start with Google Cloud’s Enterprise Search in Generative AI App Builder (Gen App Builder) to enhance clinical workflows, making it easier for clinicians and researchers to find the needed…

Continue Reading Google Cloud, Mayo Clinic Collaborate to Bring Generative AI to Healthcare

Third-Generation Sequencing Professional Market 2031 Key Insights and Leading Players Stratos, Quantapore, Oxford Nanopore Technology, etc

“ Report on the Global Third-Generation Sequencing Professional Market for 2023 shows how the market is doing right now. Additionally, it denotes crucial market elements that help consumers make crucial business decisions and advance the expansion of market share. Request a sample report @ www.orbisresearch.com/contacts/request-sample/6798693 The report also hides basic…

Continue Reading Third-Generation Sequencing Professional Market 2031 Key Insights and Leading Players Stratos, Quantapore, Oxford Nanopore Technology, etc

Blast reads classification

I am using MagicBLAST to classify reads obtained from NGS analysis on highly degraded DNA samples. I chose to use MagicBLAST because I read that it is optimal for short sequences and it allows me to use Fastq format and perform paired-end analysis, unlike blast+. The command I am running…

Continue Reading Blast reads classification

REST API with IBM App Connect with OpenAPI 3.0

REST API with IBM App Connect with OpenAPI 3.0 REST API with IBM App Connect with OpenAPI3.0 is a way of describing HTTP-based Applications, which are typically RESTful APIs. An open API definition comes in the form of a YAML or JSON file that describes the inputs and outputs of…

Continue Reading REST API with IBM App Connect with OpenAPI 3.0

Understanding Cosine Similarity in Python with Scikit-Learn

Cosine similarity proved useful in many different areas, such as in machine learning applications, natural language processing, and information retrieval. After reading this article, you will know precisely what cosine similarity is, how to run it with Python using the scikit-learn library (also known as sklearn), and when to use…

Continue Reading Understanding Cosine Similarity in Python with Scikit-Learn

Generative AI Support in Google’s Vertex AI Now Generally Available, Partners Benefit from Its Features

Google has revealed that generative AI support in Vertex AI, the company’s machine learning platform, is now generally available. The features draw from Google’s models, such as PaLM 2, Imagen, and Codey. With Vertex AI, developers can access PaLM’s features for text generation and classification, creating ChatGPT-like multi-turn chat experiences,…

Continue Reading Generative AI Support in Google’s Vertex AI Now Generally Available, Partners Benefit from Its Features

Apply for samples

BioResource biobanking We extract DNA from blood or saliva donated by our participants. The DNA is quality controlled, banked  and then analysed to study genetic variation by genotyping. We also store plasma and serum from blood samples. All samples are sent to the NIHR-funded National Biosample Centre (NBC) in Milton Keynes, for processing,…

Continue Reading Apply for samples

DataStax Adds Vector Search to Astra DB on Google Cloud

With so much data piling up everywhere, loaded database nodes are becoming a serious challenge for users to search faster and more accurately to find what they are seeking. DataStax, which makes a real-time database cloud service built upon open source Apache Cassandra, announced today that its Database as a…

Continue Reading DataStax Adds Vector Search to Astra DB on Google Cloud

Best AI Software 2023

The demand for artificial intelligence software (AI) has increased significantly in recent years, and organizations of all sizes are adopting artificial intelligence to stay competitive. The top AI software and services detailed in this article use artificial intelligence techniques such as generative AI, machine learning, natural language processing, computer vision,…

Continue Reading Best AI Software 2023

Google’s generative AI support in Vertex AI is now generally available

Google announced coming that its generative AI support in Vertex AI, The company’s instrumentality learning platform, is now mostly available. Based connected Google’s models for illustration PaLM 2, Imagen and Codey, Vertex AI offers developers entree to The PaLM’s features for generating and classifying text, building ChatGPT-like multi-turn chat experiences…

Continue Reading Google’s generative AI support in Vertex AI is now generally available

Salesforce Extends Data Cloud With Google Cloud Platform Partnership

Salesforce recognizes that customers could have data stored in external systems, as well as custom AI models. The new partnership with Google Cloud allows organizations to bring data and large language models (LLMs) from Google, to support what happens within Salesforce Data Cloud.  Data Cloud is Salesforce’s CDP (customer data…

Continue Reading Salesforce Extends Data Cloud With Google Cloud Platform Partnership

ChatGPT optimized for bioinformatics questions

Tool:ChatGPT optimized for bioinformatics questions 1 Hey everyone! I launched a new chatbot today that is bioinformatics focused! It’s trained on bioinformatics content and should help debug / ideate much faster for you than vanilla ChatGPT. Check it out here: ai.tinybio.cloud/chat Thanks! gpt • 165 views • link updated 1…

Continue Reading ChatGPT optimized for bioinformatics questions

Google’s generative AI support in Vertex AI is now generally available

Google announced today that its generative AI support in Vertex AI, the company’s machine learning platform, is now generally available. Based on Google’s models like PaLM 2, Imagen and Codey, Vertex AI offers developers access to the PaLM’s features for generating and classifying text, building ChatGPT-like multi-turn chat experiences and…

Continue Reading Google’s generative AI support in Vertex AI is now generally available

Neo4j Announces New Product Integrations with Generative AI Features in Google Cloud Vertex AI

Enterprise customers can now leverage knowledge graphs with Google’s large language models to make generative AI outcomes more accurate, transparent, and explainable SAN MATEO, Calif., June 7, 2023 /PRNewswire/ — Neo4j®, the world’s leading graph database and analytics company, announced a new product integration with Google Cloud’s latest generative AI…

Continue Reading Neo4j Announces New Product Integrations with Generative AI Features in Google Cloud Vertex AI

View All Jobs/Careers – Emory Healthcare/Emory University Assistant Bioinformatics Scientist

Discover Your Career at Emory University Emory University is a leading research university that fosters excellence and attracts world-class talent to innovate today and prepare leaders for the future. We welcome candidates who can contribute to the diversity and excellence of our academic community. Description The Department of Orthopaedics at…

Continue Reading View All Jobs/Careers – Emory Healthcare/Emory University Assistant Bioinformatics Scientist

Query regarding phyloseq object construct with QIIME output

Query regarding phyloseq object construct with QIIME output 0 @6d5973d2 Last seen 15 hours ago India I used qiime pipeline to analyze 16s amplicon sequencing data now I want to take those outputs into r studio with the help of phyloseq package and want to create phyloseq object that’s how…

Continue Reading Query regarding phyloseq object construct with QIIME output

google cloud vertex ai – Using Langchain with BigQuery – Error with tables containing RECORD fields

I’m trying to build a simple Text to Query pipeline using Langchain, BigQuery and Vertex LLM. Initiating the langchain SQLDatabase Object works fine from sqlalchemy import * from sqlalchemy.engine import create_engine from sqlalchemy.schema import * from langchain import SQLDatabase, SQLDatabaseChain dataset_id = ‘ecomm’ table_uri = f”bigquery://{PROJECT_ID}/{dataset_id}” engine = create_engine(f”bigquery://{PROJECT_ID}/{dataset_id}”) db…

Continue Reading google cloud vertex ai – Using Langchain with BigQuery – Error with tables containing RECORD fields

Can anyone medical/scientific advise? CYP2D6 metabolism, SSRI plus Wellbrutin (lexapro vs prozac)

Am trying to decide which SSRI to augment buproprion – whether lexapro or prozac. The question in my mind is that Fluoxetine is metabolised by CYP2D6 and buproprion inhibits CY2D6. Can anyone please explain to me why it is important that fluoextine is metabolised? Does it matter if it is…

Continue Reading Can anyone medical/scientific advise? CYP2D6 metabolism, SSRI plus Wellbrutin (lexapro vs prozac)

CRISPR and CAS Gene Market See Incredible Growth 2023-2030

Description: The latest research from Coherent Market Insights, titled “Global CRISPR and CAS Gene Market Size, Share, Pricing, Trends, Growth, Report and Forecast 2023-2030,” offers a detailed analysis of the global CRISPR and CAS Gene market. This research comprehensively covers the CRISPR and CAS Gene market drivers, emerging trends, development opportunities, and…

Continue Reading CRISPR and CAS Gene Market See Incredible Growth 2023-2030

Trying to edit VCF file

Trying to edit VCF file 0 Hi, I’ve been trying to take some samples out of a file but it appears its only taken some of the information out. When I tried to run a code I had in R that works for all the samples it gave me an…

Continue Reading Trying to edit VCF file

Metagenomics Market – Advancing Understanding of Microbial

Newark, New Castle, USA – new report, titled Metagenomics Market The report has been put together using primary and secondary research methodologies, which offer an accurate and precise understanding of the Metagenomics market. Analysts have used a top-down and bottom-up approach to evaluate the segments and provide a fair assessment…

Continue Reading Metagenomics Market – Advancing Understanding of Microbial

r – Support of nanotime by RSQLite

I am looking into what is required to support nanotime objects in RSQLite queries. They are just integer64 wrappers. Here is an example: con <- DBI::dbConnect(RSQLite::SQLite(), “:memory:”) ts <- nanotime::as.nanotime(Sys.time()) str(ts) # integer64 2023-06-04 17:30:21.669581000 DBI::dbGetQuery(con, ‘SELECT :ts AS x’, list(‘ts’ = ts)) # returns 5.757609e-196 tsi <- bit64::as.integer64(ts) DBI::dbGetQuery(con,…

Continue Reading r – Support of nanotime by RSQLite

NGS Library Preparation Market – Sequencing Solutions,

NGS Library Preparation Market Newark, New Castle, USA – new report, titled NGS Library Preparation Market The report has been put together using primary and secondary research methodologies, which offer an accurate and precise understanding of the NGS Library Preparation market. Analysts have used a top-down and bottom-up approach to…

Continue Reading NGS Library Preparation Market – Sequencing Solutions,

I need help with a blast command, please help

I need help with a blast command, please help 0 I have this command: blastn -db /home/BLAST_nt/nt -query otu_greedy_0.97_82.fasta -outfmt 5 -out otu_greedy_0.97_82_blastn.xml -evalue 0.001 And i have to include the following conditions: percent identity of 95%, e-value of 0.001, minimum query coverage of 100%, best hit score edge of…

Continue Reading I need help with a blast command, please help

Biomedicines | Free Full-Text | High-Accuracy ncRNA Function Prediction via Deep Learning Using Global and Local Sequence Information

1. Introduction In recent years, growing access to massive transcriptome sequencing technologies has led to the discovery of an increasing number of novel transcripts from various species. The majority of these transcripts result in non-coding ribonucleic acid (ncRNA) molecules, short sequences of RNA that, with the exception of a small…

Continue Reading Biomedicines | Free Full-Text | High-Accuracy ncRNA Function Prediction via Deep Learning Using Global and Local Sequence Information

tonb-dependent receptor plug, maker-scaffold139_size317827-snap-gene-2.25 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of tonb-dependent receptor plug vs. L. salmonis genes Match: EMLSAG00000004748 (supercontig:LSalAtl2s:LSalAtl2s24:993307:1011904:-1 gene:EMLSAG00000004748 transcript:EMLSAT00000004748 description:”maker-LSalAtl2s24-augustus-gene-10.16″) HSP 1 Score: 80.8777 bits (198), Expect = 8.252e-17Identity = 61/199 (30.65%), Postives = 98/199 (49.25%), Query Frame = 0 Query: 16 GANDVLVVAQEKG-DLLSTSMSLFVSKYANS—-SESGGRTVAMEVNDRKIGLKMTLNSRGIAAFARDEDKFRFRSREWKAVSIKPGINDGLYKVPSSGFEIKFSVFFIDMTKPLILVDLDASRPVDWEREYVAPFTGLEQDLDHIVKLCHKLSEDGQKEIVYLTDQIIVWDNSVRDDLFLKYQNRNGFSLPKGPVIL 209 G NDV++V Q G L ST…

Continue Reading tonb-dependent receptor plug, maker-scaffold139_size317827-snap-gene-2.25 (gene) Tigriopus kingsejongensis

Sequential intrahost evolution and onward transmission of SARS-CoV-2 variants

Emergence of a novel BA.1 sublineage through intrahost evolution We performed genomic analysis of serially collected nasopharyngeal (NP) and anterior nares (AN) samples from an immunocompromised patient (P1) with diffuse B-cell lymphoma and persistent SARS-CoV-2 Omicron BA.1 replication between December 2021 and March 2022. Over a 12-week period, we documented…

Continue Reading Sequential intrahost evolution and onward transmission of SARS-CoV-2 variants

Lack of Cas13a inhibition by anti-CRISPR proteins from Leptotrichia prophages

Summary CRISPR systems are prokaryotic adaptive immune systems that use RNA-guided Cas nucleases to recognize and destroy foreign genetic elements. To overcome CRISPR immunity, bacteriophages have evolved diverse families of anti-CRISPR proteins (Acrs). Recently, Lin et al. (2020) described the discovery and characterization of 7 Acr families (AcrVIA1–7) that inhibit…

Continue Reading Lack of Cas13a inhibition by anti-CRISPR proteins from Leptotrichia prophages

Restriction Endonuclease Products Market Unlock the Secrets of DNA: Innovating Restriction Endonuclease Solutions

PRESS RELEASE Published June 2, 2023 Newark, New Castle, USA new report, titled Restriction Endonuclease Products Market The report has been put together using primary and secondary research methodologies, which offer an accurate and precise understanding of the Restriction Endonuclease Products market. Analysts have used a top-down and bottom-up approach…

Continue Reading Restriction Endonuclease Products Market Unlock the Secrets of DNA: Innovating Restriction Endonuclease Solutions

60+ Open APIs tried, tested and de-risked – Historic table

Account Management API [Historic] Provides standardized mechanism for the management of billing and settlement accounts, as well as for financial accounting (account receivable) either in B2B or B2B2C contexts Business Partner, Customer TMF666 v2.0.0 01-Feb-18 No notes Agreement Management API [Historic] The Agreement API provides a standardized mechanism for managing…

Continue Reading 60+ Open APIs tried, tested and de-risked – Historic table

How to extract haplotype data from phased bcf files

How to extract haplotype data from phased bcf files 1 Hello, I have filtered/processed phased bcf files from wgs. I would like to extract the haplotype data per sample, so that I have a tab delim file which looks like this: Sample Chr Pos hap1 hap2 AW23 chr1 1234 A…

Continue Reading How to extract haplotype data from phased bcf files

Optimum setting for local blastp for ~10K sequences

Optimum setting for local blastp for ~10K sequences 0 Hi all, I’m trying to blast around 10,000 protein sequences against nr with blastp. In the past, using 100-sequence chunks and a single CPU each had worked well for blastn, but blastp seems to be much slower. A .fasta file with…

Continue Reading Optimum setting for local blastp for ~10K sequences

Single Cell Multiomics Market is Projected to Grow at a Tremendous CAGR of 21.4% by 2030

Single cell multiomics analysis assimilates multiple data sets from the genome, epigenome, transcriptome, proteome, providing a unique chance to uncover novel biological processes. Integrated approaches combine individual omics data in a sequential or simultaneous manner to understand the interplay of molecules. Furthermore, they help in assessing the flow of information…

Continue Reading Single Cell Multiomics Market is Projected to Grow at a Tremendous CAGR of 21.4% by 2030

Lytics Partners with Google Cloud on New Generative AI

Lytics data management, enrichment, and discovery tools–powered by Google Vertex AI–gives enterprise customers ways to readily access and apply 1st-party data Lytics, a next-generation customer data platform (CDP), and Google Cloud, today announced a deepening of their strategic partnership including the availability of three first-of-a-kind CDP capabilities, Lytics Audience Generator,…

Continue Reading Lytics Partners with Google Cloud on New Generative AI

Data is not displaying in DATABASE……error is not showing in IDE

// Hello, // I am facing problem in displaying data which is uploaded in web server. I am struggling since long but couldn’t find a way out. // Can i get some help, please? // I am attaching a part of the code i used for reference. Please let me…

Continue Reading Data is not displaying in DATABASE……error is not showing in IDE

Transfer learning enables predictions in network biology

Vaswani, A. et al. Attention is all you need. Preprint at doi.org/10.48550/arXiv.1706.03762 (2017). Devlin, J., Chang, M. W., Lee, K. & Toutanova, K. BERT: pre-training of deep bidirectional transformers for language understanding. In Proc. 2019 Conference North American Chapter of the Association for Computational Linguistics: Human Language Technologies Vol. 1…

Continue Reading Transfer learning enables predictions in network biology

Global DNA Sequencing Technologies Market Business Strategy, Overview, Competitive Strategies and Forecasts 2023

The market research conducted by Global DNA Sequencing Technologies Market provides a comprehensive analysis of the global market with a focus on future projections. The study is segmented into various sections, each examining the events and factors that are likely to have a significant impact in the upcoming years. To arrive at…

Continue Reading Global DNA Sequencing Technologies Market Business Strategy, Overview, Competitive Strategies and Forecasts 2023

Genomics Market: Advancements in DNA Sequencing

Genomics Market Allied Market Research Analyst have added a new research study on Title Genomics Market, Global Outlook and Forecast 2023-2030 with detailed information & Key Players Such as Agilent Technologies, Thermo Fisher Scientific, Bio-Rad Laboratories, Danaher, BGI, Illumina, Pacific Biosciences, Oxford Nanopore Technologies, 23andMe, Foundation Medicine. The Study provides…

Continue Reading Genomics Market: Advancements in DNA Sequencing

Lytics Partners with Google Cloud on New Generative AI Capabilities

Lytics data management, enrichment, and discovery tools–powered by Google Vertex AI–gives enterprise customers ways to readily access and apply 1st-party data SAN FRANCISCO, CA, USA, May 31, 2023/EINPresswire.com/ — Lytics, a next-generation customer data platform (CDP), and Google Cloud, today announced a deepening of their strategic partnership including the availability…

Continue Reading Lytics Partners with Google Cloud on New Generative AI Capabilities

How to determine the exact version of hg38 if I have only the FASTA file

How to determine the exact version of hg38 if I have only the FASTA file 1 I have a FASTA file which contains hg38 assembly. It contains the primary contigs, alt contigs, decoy, HLA, mito. How do I determine the exact version of hg38 based on the FASTA? Here some…

Continue Reading How to determine the exact version of hg38 if I have only the FASTA file

Analytics startup Lytics partners with Google Cloud to build new AI features

Google LLC’s cloud unit today detailed that Lytics Inc., a venture-backed analytics startup, has used its platform to build three new artificial intelligence features for users. Portland-based Lytics provides a customer data platform, or CDP, of the same name. A CDP is an application that allows companies to aggregate customer…

Continue Reading Analytics startup Lytics partners with Google Cloud to build new AI features

Google’s Generative AI Stack: An In-Depth Analysis

At the recently concluded Google I/O 2023 conference, the search giant unveiled its generative AI strategy. From Bard to Project Tailwind, generative AI dominated the conference. Google’s long-term investment in AI-related research led to the creation of powerful foundation models, which have become the core of the new product and…

Continue Reading Google’s Generative AI Stack: An In-Depth Analysis

biopython – Why does my for loop in Python never stop running?

I am creating a code that takes accession numbers from an existing excel file and ultimately running it through BLAST using Entrez. I am very new to Python and pretty much just learning as a I write. Here is what my code looks like right now, it currently will run…

Continue Reading biopython – Why does my for loop in Python never stop running?

Differential Binding of NLRP3 to non-oxidized and Ox-mtDNA mediates NLRP3 Inflammasome Activation

NLRP3 expression and purification Both wild-type NLRP3 and CAPS mutants were cloned in the mammalian expression vector pcDNA3.1HisB. Plasmid was purified using Qiagen Giga Prep up to 2000 ng/μl and subsequently transfected into Expi293 with Expifectamine per manufacturer instructions. Expression was allowed to proceed for 3 days before harvesting. Cells were…

Continue Reading Differential Binding of NLRP3 to non-oxidized and Ox-mtDNA mediates NLRP3 Inflammasome Activation

CircSSNN: circRNA-binding site prediction via sequence self-attention neural networks with pre-normalization | BMC Bioinformatics

Datasets To verify the effectiveness of the CircSSNN, we adopted 37 circRNA datasets as benchmark datasets following the baselines we compared [15, 16]. We first downloaded the datasets from the circRNA interactome database (circinteractome.nia.nih.gov/). Subsequently, we obtained 335,976 positive samples and 335,976 negative samples following the process of iCircRBP-DHN [17]….

Continue Reading CircSSNN: circRNA-binding site prediction via sequence self-attention neural networks with pre-normalization | BMC Bioinformatics

Mild Cognitive Impairment (MCI) Treatment Market Size, Share, Growth & Trends Analysis Report By Product, By End Use, By Region, Competitive Landscape and Recent Developments Forecasts

Data Bridge Market Research announces the release of the report “Mild Cognitive Impairment (MCI) Treatment Market Size, Share, Growth & Trends Analysis Report By Product, By End Use, By Region And Segment Forecasts”. An excellent Mild Cognitive Impairment (MCI) Treatment market document concentrates on the global key manufacturers to define,…

Continue Reading Mild Cognitive Impairment (MCI) Treatment Market Size, Share, Growth & Trends Analysis Report By Product, By End Use, By Region, Competitive Landscape and Recent Developments Forecasts

Celiac Disease Treatment Pipeline Drug Evaluation Market Report By 2023 To 2030 Trends, Drivers And Opportunities Forcast

PRESS RELEASE Published May 29, 2023 Celiac Disease Treatment Pipeline Drug Evaluation Market Premium Research Report during the forecast years 2029 | No Pages 101 | Number of Tables and Figures | Global Celiac Disease Treatment Pipeline Drug Evaluation Industry production, Potential Application, demand, Global key Players (, ImmusanT, Calypso…

Continue Reading Celiac Disease Treatment Pipeline Drug Evaluation Market Report By 2023 To 2030 Trends, Drivers And Opportunities Forcast

python – Unable to access individual alignment strings in biopython pairwise align

I’m trying to access individual strings in the alignment object which is produced by the pairwise aligner in biopython but not getting anywhere. I’m talking about the already aligned sequences showing gaps, as given by the print(alignment), but trying to get them individually or even slice. The documentation stipulates it’s…

Continue Reading python – Unable to access individual alignment strings in biopython pairwise align

Symfony PHP Developer, Enterprise/OpenAPI – Remote for Candidates in US based Central or Eastern Time Zone

Optavise, a CNO Financial Group Company is seeking a Developer to complete small to medium sized projects with low to moderate supervision. Often the source of advice, the Developer will offer thought leadership to achieve strategies and objectives and resolve impediments. This role should be motivated and ready to mentor…

Continue Reading Symfony PHP Developer, Enterprise/OpenAPI – Remote for Candidates in US based Central or Eastern Time Zone

What American Technology Companies Are Thinking About AI

The way I see it, artificial intelligence (or AI), really leapt into the zeitgeist in late-2022 or early-2023 with the public introduction of DALL-E2 and ChatGPT. Both are provided by OpenAI and are software products that use AI to generate art and writing, respectively (and often at astounding quality). Since…

Continue Reading What American Technology Companies Are Thinking About AI

Query qbout single cell sequencing

Query qbout single cell sequencing 0 I am a new student working with scRNA seq data regarding which i have a few queries. can single cell rna-sequencing both single end or paired end ? If paired end then what information is in _1 and _2 fastq files because i have…

Continue Reading Query qbout single cell sequencing

Solved 0 out of 7.5 points suitable for Match the

Transcribed image text: 0 out of 7.5 points suitable for Match the followings: BLAST The Entrez Protein online database examples PubChem’s BioAssay database GenBank A. It takes the query sequence from the user and search against entire NCBI databases for similarity and then posts the output back to the person’s…

Continue Reading Solved 0 out of 7.5 points suitable for Match the

Emory University hiring Associate Scientist, Bioinformatics – School of Medicine (Biochemistry) in Atlanta, Georgia, United States

Discover Your Career at Emory University Emory University is a leading research university that fosters excellence and attracts world-class talent to innovate today and prepare leaders for the future. We welcome candidates who can contribute to the diversity and excellence of our academic community. Description JOB DESCRIPTION: The Associate Scientist,…

Continue Reading Emory University hiring Associate Scientist, Bioinformatics – School of Medicine (Biochemistry) in Atlanta, Georgia, United States

Unleashing the Power of LLM for Enterprise Applications with LangChain

LangChain has become one of the most talked about topics in the developer ecosystem, especially for those building enterprise applications using large language models for natural interactions with data.  In a recent blog post ‘Breaking the Language Model Barriers with LangChain’, associate consultant–Python and AI developer–at Infosys and Intel openAPI…

Continue Reading Unleashing the Power of LLM for Enterprise Applications with LangChain

Occurrence and genetic diversity of prophage sequences identified in the genomes of L. casei group bacteria

Occurrence of prophage sequences in L. casei group genomes The first stage of the analysis involved the identification of prophage-like sequences in 439 genomic sequences of bacterial strains belonging to the following 5 species: L. casei (27), L. paracasei (200), L. rhamnosus (204), L. zeae (6) and L. chiayiensis (2)….

Continue Reading Occurrence and genetic diversity of prophage sequences identified in the genomes of L. casei group bacteria

Next Generation DNA Sequencing (NGS) Market Analysis and In-depth study on Market Size Trends, Emerging Growth Factors and Regional Forecast to 2029

PRESS RELEASE Published May 26, 2023 Data Bridge Market Research announces the release of the report “Next Generation DNA Sequencing (NGS) Market Size, Share, Growth & Trends Analysis Report by Product, By End Use, By Region and Segment Forecasts”. An excellent Next Generation DNA Sequencing (NGS) market document concentrates on…

Continue Reading Next Generation DNA Sequencing (NGS) Market Analysis and In-depth study on Market Size Trends, Emerging Growth Factors and Regional Forecast to 2029

python – Custom batch sampler for pytorch dataloader

I am trying to write a pytorch dataloader to use variable batch size for my data based on an id column. id label feature 1 1 5 1 0 5 2 1 5 3 0 5 For this example data, I want to have 3 batches, all data of id==1,…

Continue Reading python – Custom batch sampler for pytorch dataloader

Segmentation fault Biopython pairwise alignment

Segmentation fault Biopython pairwise alignment 0 Hi everybody ! I’m working in order to create my own pairwise sequence alignment program in Python. I use the pairwise2.align command from Bipython. When I use it with small sequences it works. I put the code bellow (2 for a match, -2 for…

Continue Reading Segmentation fault Biopython pairwise alignment

Integrate a qnode supporting parameter broadcast into a pytorch model – PennyLane Help

Currently, I’m working on a quantum neural network that integrates a Qnode into a PyTorch model. To accelerate the computation, I use the ‘Parameter broadcast’ feature. The device I used is default.qubit. However, it only works when the diff_method is backprop. When use parameter_shift or adjoint, it will throw error…

Continue Reading Integrate a qnode supporting parameter broadcast into a pytorch model – PennyLane Help

View All Jobs/Careers – Emory Healthcare/Emory University Scientist, Assistant Bioinformatics

Discover Your Career at Emory University Emory University is a leading research university that fosters excellence and attracts world-class talent to innovate today and prepare leaders for the future. We welcome candidates who can contribute to the diversity and excellence of our academic community. Description JOB DESCRIPTION: Under minimal supervision,…

Continue Reading View All Jobs/Careers – Emory Healthcare/Emory University Scientist, Assistant Bioinformatics

Vertex AI Embeddings for Text: Grounding LLMs made easy

Also, Foundational courses: Embeddings on Google Machine Learning Crush Course and Meet AI’s multitool: Vector embeddings by Dale Markowitz are great materials to learn more about embeddings. LLM text embedding business use cases With the embedding API, you can apply the innovation of embeddings, combined with the LLM capability, to…

Continue Reading Vertex AI Embeddings for Text: Grounding LLMs made easy

protein abrupt-like isoform x1, maker-scaffold97_size377342-snap-gene-2.14 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of protein abrupt-like isoform x1 vs. L. salmonis genes Match: EMLSAG00000011120 (supercontig:LSalAtl2s:LSalAtl2s753:207020:208693:1 gene:EMLSAG00000011120 transcript:EMLSAT00000011120 description:”augustus_masked-LSalAtl2s753-processed-gene-1.1″) HSP 1 Score: 342.043 bits (876), Expect = 1.286e-109Identity = 269/559 (48.12%), Postives = 311/559 (55.64%), Query Frame = 0 Query: 168 DNFGPSAPKRHRFNGPESRNSPSSSPKSLADWGRRSLEPKTEDTAEADNNNSTPKSESLLSQALEKHSNVSSMYDRHLLRDNGDGRDGDSASDTTSERPESLMDGLIKNSGAESELHRQLSAASPASMGGHLFPPGLEALYRQAGFPSAFLGLAAGAA—-GGSPGG————–PVSSMHGLASSVPQVGLQSHAGNPN—————————————–LAGKLDMMRVRATDPRPCPKCGKIYRSAHTLRTHMEDKHTICPGYRCVLCGTVAKSRNSLHSHMSRQHRGISTKDLPVLPMPSPFDPALASRLLAKAGVKVTPNELAARASPTAPRRSDLPKLDTNLLHM-HHHQFPLPPSLPT-SMSGHMGRGSHDGNGSDVEDLRVSSAPSPFGSNGGPGGIYSQAHQMRIAQGMLSPKDFA–ALASAGGAQGAAGMGSALLDTYLSMI-AAAGGDSNPMAAALNFQ-NPASRAAAFAAAAAAASGNQAHNGDGKDNDQRSGVSEDRDDMTGELGSDADNDDLSDNDD 661 D++ P PKRHR NG E…

Continue Reading protein abrupt-like isoform x1, maker-scaffold97_size377342-snap-gene-2.14 (gene) Tigriopus kingsejongensis

NVIDIA Corp. (NVDA) Q1 2024 Earnings Call Transcript

NVIDIA Corp. (NASDAQ:NVDA) Q1 2024 Earnings Conference Call May 24, 2023 5:00 PM ET Company Participants Simona Jankowski – VP, IR Colette Kress – EVP & CFO Jensen Huang – Co-Founder, CEO & President Conference Call Participants Toshiya Hari – Goldman Sachs C.J. Muse – Evercore ISI Vivek Arya –…

Continue Reading NVIDIA Corp. (NVDA) Q1 2024 Earnings Call Transcript

Prediction of protein subplastid localization and origin with PlastoGram

Data sets To create data sets of sequences corresponding to compartments of photosynthetic plastids, we searched the UniProt database for proteins annotated as localized in the chloroplast. Importantly, the UniProt keyword ’Chloroplast’ includes not only chloroplasts of green algae and land plants but also plastids of Rhodophyta, haptophytes and the…

Continue Reading Prediction of protein subplastid localization and origin with PlastoGram

Nvidia (NVDA) Q1 2024 Earnings Call Transcript

Image source: The Motley Fool. Nvidia (NVDA -0.49%)Q1 2024 Earnings CallMay 24, 2023, 4:45 p.m. ET Contents: Prepared Remarks Questions and Answers Call Participants Prepared Remarks: Operator Good afternoon. My name is David, and I’ll be your conference operator today. At this time, I’d like to welcome everyone to NVIDIA’s first-quarter earnings…

Continue Reading Nvidia (NVDA) Q1 2024 Earnings Call Transcript

Datasets best practices – Google Cloud Community

I am new to ML and VertexAI. I have some questions about an app I am building that requires image classification labels. The closest example I can think of is that mobile app which identifies plants, like PlantNet. You take a photo, and it returns the type of plant, ideally…

Continue Reading Datasets best practices – Google Cloud Community

Obtaining the AF and DP values for variants in a VCF

So I was able to retrieve this information using bcftools query. As stated in the bcftools documentation, the FORMAT fields can be accessed if they are declared in square brackets. I stored the values for AF and DP in a csv file (stats.csv) using this command: bcftools query -f'[%CHROM,%POS,%AF,%DP\n]’ SAMPLE_3.vcf…

Continue Reading Obtaining the AF and DP values for variants in a VCF

Help: LitScan

# Total IDs searched 9,648,246 IDs being used by LitScan 8,939,826 Unique RNA sequences 4,497,573 Articles found 865,179 RNAcentral LitScan is a new text mining pipeline that connects RNA sequences with the latest open access scientific literature. LitScan uses a collection of identifiers (Ids), gene names, and synonyms provided to…

Continue Reading Help: LitScan

Uniprot API access to download .pdb files

Uniprot API access to download .pdb files 0 Hey everyone, fairly new to Bioinformatics so please cut me some slack. Anyways, I am trying to work with the UniProt API and I am running into a bit of a wall. My goal is to write a URL that I can…

Continue Reading Uniprot API access to download .pdb files

java – OpenAPI generator How to generate method with Spring paging and sorting

I am trying to generate as much code as possible for application using OpenAPI generator. Some of the requests are get with support for paging and sorting. Using spring it is easy to create @GetMapping(“/snakes”) public ResponseEntity<List<Snake>> findAll(Pageable pageable) This makes the /snakes endpoint to support paging and sorting using…

Continue Reading java – OpenAPI generator How to generate method with Spring paging and sorting

University of Rochester hiring Jr Bioinformatics Analyst in Medicine, Nebraska, United States

Opening Full Time 40 hours Grade 052 Ctr for Advanced Research Tech Schedule 8 AM-5 PM Responsibilities GENERAL PURPOSE: The Genomics Research Center (GRC) at the University of Rochester is seeking a highly motivated and organized candidate to provide comprehensive analysis support of high-throughput sequence data to customers of the…

Continue Reading University of Rochester hiring Jr Bioinformatics Analyst in Medicine, Nebraska, United States

#1 technology industry analyst breaks down the Cohesity Catalyst 2023 announcements.

Cohesity Catalyst is a three-day global online event from May 23 to 25 that I think is a must-attend for data security and management pros. Cohesity has assembled an impressive lineup of genuine thought leaders from companies such as Mandiant, VMware, NetApp, AWS, Google Cloud, IBM, Cisco, and HPE—a testament…

Continue Reading #1 technology industry analyst breaks down the Cohesity Catalyst 2023 announcements.

Phenotype and organism model references for a large list of genes

Phenotype and organism model references for a large list of genes 1 Hi all. I have to generate table for about 3500 genes with following columns: 1) references to each gene; 2) pathological features 3) reference to the organism model, e.g. MGI number for mouse Are there any databases/softwares, which…

Continue Reading Phenotype and organism model references for a large list of genes

GenBank Overview

2 hours ago Article URL: www.ncbi.nlm.nih.gov/genbank/ Comments URL: news.ycombinator.com/item?id=36038722 Points: 1 # Comments: 0 GenBank OverviewWhat is GenBank?GenBank ® is the NIH genetic sequence database, an annotated collection of all publicly available DNA sequences (Nucleic Acids Research, 2013 Jan;41(D1):D36-42). GenBank is part of the International Nucleotide Sequence Database Collaboration, which…

Continue Reading GenBank Overview

Metagenomics in Healthcare Market Drivers, Revenue, Growth Projections, Opportunities, Application and Industry Demand Analysis 2030

New Jersey, United States,- This market research report offers insights into the size and forecast of the Metagenomics in Healthcare Market. It provides a comprehensive understanding of the industry’s growth patterns and trends during the forecast period. The report also analyzes the different segments and sub-segments of the market and provides…

Continue Reading Metagenomics in Healthcare Market Drivers, Revenue, Growth Projections, Opportunities, Application and Industry Demand Analysis 2030

What Is Distributed Learning In Machine Learning?

Distributed learning has emerged as a crucial technique for tackling complex problems and harnessing the power of large-scale data processing. But what exactly is distributed learning in machine learning? Why is it so important? In this article, we will explore the concept of distributed learning and its significance in the…

Continue Reading What Is Distributed Learning In Machine Learning?

open-cravat: variant annotation tool

Tool:open-cravat: variant annotation tool 3 open-cravat is an open-source platform for rapidly developing, using, and disseminating variant annotation tools. It can handle unlimited number of variants in VCF format input files as well as its own input format and produce tab-separated text output files and excel spreadsheets. It is command-line-based…

Continue Reading open-cravat: variant annotation tool

Comparing gene expression with copy number variation in TCGA

Hello, I want to compare (with a PCA) gene expression against copy number variation at gene level in a TCGA project.When I retrieve the gene expression every value is mapped by sample and gene. But for the copy number variation, I get only chromosomal locations.To do the PCA, I want…

Continue Reading Comparing gene expression with copy number variation in TCGA

Sample GenBank Record / Visual abstracts made easy with Mind the Graph

This page presents an annotated sample GenBank record (accession number U49845) in its GenBank Flat File format. You can check the corresponding alive record for U49845, and seeexamples of other records the show a range of biological features. SITE SCU49845 5028 bp DNA PLN 21-JUN-1999 DEFINITION Saccharomyces cerevisiae TCP1-beta gene,…

Continue Reading Sample GenBank Record / Visual abstracts made easy with Mind the Graph

An OSS Stack for Real-Time AI: Cassandra, Pulsar and Kaskada

In the world of academia, the hard problems posed by machine learning revolve around building better, smarter models and finding more and better data. I and my co-author know from our days as Ph.D. students that there’s plenty of time to build models, and data moves slowly — if at…

Continue Reading An OSS Stack for Real-Time AI: Cassandra, Pulsar and Kaskada

Using Apache Age for Bioinformatics: Exploring Protein-Protein Interaction Networks

The field of bioinformatics has rapidly evolved with the advent of high-throughput sequencing technologies and other advanced experimental methods. These technologies generate massive datasets that require equally advanced computational methods for analysis. Graph databases, such as Apache Age, have emerged as powerful tools for managing and analyzing these complex datasets….

Continue Reading Using Apache Age for Bioinformatics: Exploring Protein-Protein Interaction Networks

Download JetBrains DataSpell 2023.1.2 – SoftArchive

JetBrains DataSpell is an IDE for data science with intelligent Jupyter notebooks, interactive Python scripts, and lots of other built-in tools. Intelligent Jupyter notebooksTuned for high interactivitySwitch between command and editor modes with a single keystroke. Navigate over cells with arrow keys. Use all of the standard Jupyter shortcuts. Enjoy…

Continue Reading Download JetBrains DataSpell 2023.1.2 – SoftArchive

Cancer Gene Therapy Market : Opportunity Analysis and Industry Forecast 2030 | CAGR 23.3%

Cancer gene therapy is a technique used for the treatment of cancer where therapeutic DNA is being introduced into the gene of the patient with cancer. Owing to the high success rate during the preclinical and clinical trials, cancer gene therapy has gained popularity. There are many techniques used for…

Continue Reading Cancer Gene Therapy Market : Opportunity Analysis and Industry Forecast 2030 | CAGR 23.3%

BLAST Basic Local Alignment Search Tool

Keywords BLAST, bioinformatics, heuristic algorithm, program, biological sequence, proteins, nucleotides, database sequences, maximal segment pair, alignments, DNA and RNA sequences. Introduction BLAST (basic local alignment search tool) in bioinformatics, is an algorithm and program for comparing primary biological sequence information, such as the amino acid sequences of proteins or the…

Continue Reading BLAST Basic Local Alignment Search Tool

Metagenomic Sequencing Market trends, Analysis and Forecast

New Jersey, United States – The Global Metagenomic Sequencing Market report offers a comprehensive analysis that combines qualitative and quantitative insights. It covers macro and micro aspects, including market dynamics, industry structure, market size, and segmentation by type and application. The report delves into the influencing factors, highlighting significant market changes, obstacles, and…

Continue Reading Metagenomic Sequencing Market trends, Analysis and Forecast

Genomic and phylogenetic analysis of Klebsiella michiganens

Introduction Multidrug-resistant Enterobacteriaceae infection is a severe threat to public health that is worsening globally and is associated with increasing mortality rates.1 Klebsiella pneumoniae is a significant pathogen that contributes to the dissemination of multidrug-resistant strains in healthcare environments.2 K. michiganensis is a novel specie of pathogenic Klebsiella genus. Since…

Continue Reading Genomic and phylogenetic analysis of Klebsiella michiganens

Explosive Growth Forecasted for Tumor Ablation Market: CAGR of 11.5% from 2023 to 2030

Tumor Ablation Market Research Report :- In the realm of cancer treatment, advancements in technology have paved the way for innovative and minimally invasive procedures. One such technique that is gaining traction and poised for remarkable growth is tumor ablation. With a projected compound annual growth rate (CAGR) of 11.5%…

Continue Reading Explosive Growth Forecasted for Tumor Ablation Market: CAGR of 11.5% from 2023 to 2030

Carl Icahn and Illumina Square Off Soon. The Stakes Are High.

Carl Icahn, one of Wall Street’s fiercest activists, is taking a big swipe next week, as he attempts to unseat the brash CEO of Illumina, the dominant player in the field of gene sequencing. Illumina ’s (ticker: ILMN) sequencing machines are behind scientific advances already changing science and medicine. The…

Continue Reading Carl Icahn and Illumina Square Off Soon. The Stakes Are High.

Amazon Omics Beefs up Managed Services with Pre-Built Workflows, GPU Support

BOSTON – Amazon Web Services this week introduced new features for its nascent Amazon Omics service, including a collection of “pre-built” workflows, support for graphical processing units (GPUs), direct data uploads through an application programming interface (API), and streamlined variant querying and analysis. AWS launched Amazon Omics last November. The…

Continue Reading Amazon Omics Beefs up Managed Services with Pre-Built Workflows, GPU Support

angular – Cannot get the data from openAPI service – returns undefined

I have this service that I got from processing an openAPI spec file (.yaml) and the thing is I do not get the filtered data I want. Here is the method from my service : /** * Search cases with filters * @param status status of cases to return (all…

Continue Reading angular – Cannot get the data from openAPI service – returns undefined

Sr./Principal Scientist, Bioinformatics at Frontier Medicines

Frontier Medicines is seeking a highly motivated and experienced Senior/Principal Scientist in Bioinformatics or Computational Biology to join an emerging Bioinformatics group embedded in our growing Data Sciences team. The ideal candidate has proven experience in the analysis of high-dimensional omics data derived from multiple platforms (such as RNA-seq, Chip-seq,…

Continue Reading Sr./Principal Scientist, Bioinformatics at Frontier Medicines

phylogenetics – Blast output file only shows 500 lines -outfmt 6

I’ve reproduced the issue. The solution is to simply set -max_target_seqs to whatever number of hits you want. E.g. -max_target_seqs 1000 gives 1000 and so on … The problem is specific to the -outfmt option and not default searches. blastn version I’m using v2.12.0, Feb 8 2022 Proof My database…

Continue Reading phylogenetics – Blast output file only shows 500 lines -outfmt 6

swamih fund: Government-backed SWAMIH Fund invests over Rs 158 crore in Thane housing project

The government-backed and SBICAP Ventures-managed last-mile financing platform Special Window for Completion of Construction of Affordable and Mid-Income Housing Projects (SWAMIH I) has invested Rs 158.50 crore in a residential-led mixed-use project in Thane’s Ghodbunder Road. The investment will lead to revival of the stalled project consisting of a total…

Continue Reading swamih fund: Government-backed SWAMIH Fund invests over Rs 158 crore in Thane housing project