Categories
Tag: query
CorGTA Inc. hiring Machine Learning Engineer (Vertex AI) in Canada
*****This company is a Data Consultancy & Solution Provider with high-profile clients that works with Data Scientists, Data Engineers, and Software Engineers to solve any & all business problems. (Data & Analytics Strategy, Data Governance, Data Warehousing, Predictive Analytics, & Cloud BI Services) Machine Learning Engineer (Vertex AI) Job Title:…
Demystifying Open API and OpenAPI
Demystifying Open API and OpenAPI Table of Contents Introduction Understanding APIs Open APIs: An Overview Different Levels of API Openness The Importance of Composable Architecture The Role of API Management The Evolution of API Management Solutions Open API: A Standardized Format The Benefits of Open API Open API in Practice…
Ubuntu Manpage: mash – fast genome and metagenome distance estimation using MinHash
Provided by: mash_2.3+dfsg-1build2_amd64 NAME mash – fast genome and metagenome distance estimation using MinHash SYNOPSIS mash <command> [options] [arguments …] DESCRIPTION mash is the main executable for the Mash software. The actual functionality is provided by the subtools (‘commands’): Commands bounds Print a table of Mash error bounds. dist Estimate…
Shedding Light on BIA-ALCL Risks
In a society that celebrates individuality and self-expression, the journey to aesthetics takes many forms. One such road, taken by countless women seeking empowerment and confidence, is breast augmentation. This blog dives deep into the dark and flip side of breast augmentation- Allergan breast implant lawsuits. Before answering the query…
Interventional Tumor Ablation Market by Share, Trends, Growth Factors, Developments, Product Innovation and Forecast till 2032 | Taiwan News
Report Ocean published a new report, titled, “Interventional Tumor Ablation Market 2023-2032“. The report has offered an all-inclusive analysis of the global market taking into consideration all the crucial aspects like growth factors, constraints, market developments, top investment pockets, future prospects, and trends. At the start, the report lays emphasis…
Proteomic analysis of SARS-CoV-2 particles unveils a key role of G3BP proteins in viral assembly
Capturing proteins associated with SARS-CoV-2 virions To identify host cell proteins potentially present in extracellular SARS-CoV-2 virions, viral particles were produced from two lung epithelial cell models, A549 cells overexpressing ACE2 receptor (A549-ACE2) and Calu-3 cells that naturally express ACE2 receptor and TMPRSS2. Following infection with the D614G SARS-CoV-2 strain32,…
Using ColabFold to predict protein structures | by Natan Kramskiy | Jan, 2024
A few hours before the CASP14 (14th Critical Assessment of Structure Prediction) meeting, the latest biannual structure prediction experiment where participants build models of proteins given their amino acid sequences, this image went viral on twitter. Ranking of participants in CASP14, as per the sum of the Z-scores of their…
Contract-First Approach with Node.js and OpenAPI for REST Services | by DxLoop | Jan, 2024
You might be familiar with Spring Boot, a Java framework often utilized for building Restful APIs. While the open-api-generator is a robust tool providing various features, including generating resource models, controller interfaces, executing validation logic, and even creating model and API tests, it’s important to note that the Node.js version…
Unleash the Power of Vector Search with Vertex AI
Unleash the Power of Vector Search with Vertex AI Introduction What is Vector Search? The Importance of Vector Search for Businesses Getting Started with Building Production Quality Vector Search Services with Google Cloud Vertex AI Benefits of Vector Search Technology Vector Search versus Traditional Databases How AI Organizes Data Using…
Finding EntreZ IDs for refseq IDs
Finding EntreZ IDs for refseq IDs 1 Hi all, I have a list of bacterial RefSeq IDs corresponding to protein sequences (e.g., WP_007430823.1, WP_019686959.1, etc.). I need to retrieve the corresponding EntreZ IDs for these RefSeq IDs, in order to cotinue the RNA-seq downstream analysis (GO enrichment analysis ). Here’s…
From nucleotide or proteine sequences to EC number using biopython
From nucleotide or proteine sequences to EC number using biopython 0 Hi, if I have a fasta file containing nucleotide sequences or proteines sequences is it possible to get EC number using biopython for example 1.1.1.169 1.1.1.205 1.1.1.25 1.1.1.302 1.1.1.330 1.1.1.34 ps : I’m working on fungus so I need…
Unlock the Power of Generative AI in Your Applications with Gemini | by Jay Whitsitt | Jan, 2024
It’s also a great way to adjust parameters like temperature, maximum output length, and top-k value, as well as get sample implementation code. You can request different formats of output, such as json, markdown, bullet lists, etc. We won’t get into prompt engineering or tuning these parameters here, but it’s…
Top 20 Hadoop Competitors and Alternatives
Hadoop is an open-source big data analytics platform headquartered in Baltimore, Maryland. The solution evolved from the Google File System paper published by Doug Cutting and Mike Cafarella in October 2003 as part of the Apache Nutch project. The co-founders moved the platform to the Hadoop subproject in 2006. In…
Team Leader Bioinformatics – Ryvu Therapeutics, Krakow
Team Leader Bioinformatics – Ryvu Therapeutics, Krakow Team Leader Bioinformatics Ryvu Therapeutics Krakow, Poland As Bioinformatics Team Leader you will be responsible for development of this area within Data Science department which includes managing and growing the team, setting and executing short and long term plans, propagating collaboration with other…
Lab bioinformatics questions 1 – Pharmaceutical cell biology Uppsala University Bioinformatics
Pharmaceutical cell biology Uppsala University Bioinformatics computer lab Student name: 1. Sequence alignment using BLAST You are provided with a file named ‘sequences.txt‘, containing a sequence named ‘Sequence1’, extracted from a viral sample. Your task is to identify the type of virus from which this sequence originates. Visit the NCBI…
Stream R-Studio 8.10.173981 Crack 2020 With Keygen by PlorinMconsda
published on 2023-12-20T11:52:13Z R-Studio 8.10.173981 Crack 2020 With Keygen 💡🏆🌎👉 👈🌎🏆💡 Download Zip t.co/G86gKrNMNp Same problem here. As soon as I update to latest version of Rstudio the problem began. My post: R session crashes when access files/environment/history panel RStudio IDE Hello. Cannot use RStusio because it’s not possible to…
University of North Carolina at Chapel Hill hiring Bioinformatics Data Scientist in North Carolina, United States
Posting InformationPosting Information Department Renaissance Computing Inst-637100 Career Area Information Technology Posting Open Date 09/14/2023 Application Deadline 01/02/2024 Open Until Filled No Position Type Permanent Staff (EHRA NF) Working Title Bioinformatics Data Scientist Appointment Type EHRA Non-Faculty Position Number 20059390, 20061324 Vacancy ID NF0007337 Full Time/Part Time Full-Time Permanent FTE…
Validating swagger/openapi json using openapi-validations GitHub Action | by Kushal Bhalaik | Dec, 2023
Photo by Maël BALLAND on Unsplash A few months back I had a requirement of checking the APIs for the product I’m working on for breaking changes (Backward Compatibility Check) during CI/CD. As part of that research, I created an action called openapi-validations, which is essentially a wrapper on top…
Filtering Vertex AI Search Results Based on Language in a Standard Website Indexing Application
I have created a search application using Vertex AI Search using standard website indexing. I am using the API to call the servingConfigs.search and display the results in a frontend. However, I am facing challenges in filtering the search results based on language. I want to display results according to…
Exploring Google’s Gemini For Function Calling | by Tarun Singh | Dec, 2023
Welcome to the cutting edge of artificial intelligence and coding! Today, we’re diving into Google’s latest marvel in the AI world — the Vertex AI Gemini API. This isn’t just another AI tool; it’s a game-changer, a glimpse into the future of how we interact with code and AI. Function…
Google Cloud Platform Vertex AI Architect
JD: Google Cloud Platform – Vertex AI Architect (Exp: 8 to 15 Yrs.) We are looking for an experienced Google Cloud Platform – Vertex AI Architect with expertise in the below areas Model deployment in Vertex AI Model management and monitoring Automation using Vertex Pipelines Batch and online model serving…
Business Analytics with LangChain and LLMs | by Naser Tamimi | Dec, 2023
GENERATIVE AI A Step-by-Step Tutorial on Using LangChain to Query SQL Databases with Human Language Image by the author (generated via Midjourney) Many businesses have a lot of proprietary data stored in their databases. If there’s a virtual agent that understands human language and can query these databases, it opens…
Finding the paper published from the SRA run riles
Finding the paper published from the SRA run riles 0 Hey folks, i have used this code to download a my query esearch -db sra -query ‘(“BACTERIA_NAME”[Organism] OR BACTERIA_NAME[All Fields]) AND “BACTERIA_NAME”[orgn] AND (“strategy wgs”[Properties] AND “library layout paired”[Properties] AND “filetype fastq”[Properties])’ | efetch -format runinfo -mode text > first_file.tsv…
line chart for sql database single row values
i have this type of database and i am using sql query to get the data and make graph by using chart js Protein starve_th_37°C starve_th_49°C starve_th_58°C P62424 1 0.437534765 0.214595311 Q13148 1 0.371686426 0.127905346 and i want to make line chart (three point connecting each other) for each row…
Accessing Snowflake with R Studio via ODBC on SPCS | by Gabriel Mullen | Snowflake | Dec, 2023
In a previous post, I was able to deploy a R Studio container into Snowpark Container Service. This allows me to run R code directly in Snowflake, but I still need to connect to Snowflake to grab data. So when I attempted to use the dbConnect syntax from the original…
Gemini Models with Google Vertex AI Integration for Haystack
In this article, we will introduce you to the new Google Vertex AI Integration for Haystack 2.0-Beta. While this integration introduces several new components to the Haystack eco-system (feel free to explore the full integration repo!), we’d like to start by showcasing two components in particular: the GeminiGenerator and the…
Single-cell RNA-seq workflow
In this tutorial we walk through a typical single-cell RNA-seq analysis using Bioconductor packages. We will try to cover data from different protocols, but some of the EDA/QC steps will be focused on the 10X Genomics Chromium protocol. We start from the output of the Cell Ranger preprocessing software. This…
How can Gemini Pro simplify AI for developers?
With Gemini Pro, developers are now able to achieve their desired results much faster through more straightforward methods. Gemini Pro will let developers build new and differentiated agents that can process information across text, code, images, and video. Google has also introduced Imagen 2, its most advanced text-to-image technology. A…
Understanding the output dimensionality for torch.nn.MultiheadAttention.forward
I want to implement a cross attention between 2 modalities. In my implementation, I set Q from modality A, and K and V from modality B. Modality A is used for a guidance by using cross attention, and the main operations are done in modality B. Here is the example…
AI Week In Review 23.12.16
Figure 1. Tesla’s Optimus Gen2 demo video, showing off tactile precision. Midjourney Alpha web interface is available here to super-users who generated over 10k Midjourney images. This will be a big UX upgrade for Midjourney users over the discord text prompt method. Google has released Imagen2 text-to-image generation for Vertex…
hypothetical protein LOTGIDRAFT_99224 partial, maker-scaffold1322_size48131-snap-gene-0.13 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of hypothetical protein LOTGIDRAFT_99224 partial vs. L. salmonis genes Match: EMLSAG00000006769 (supercontig:LSalAtl2s:LSalAtl2s379:476161:478870:-1 gene:EMLSAG00000006769 transcript:EMLSAT00000006769 description:”maker-LSalAtl2s379-augustus-gene-4.10″) HSP 1 Score: 59.6918 bits (143), Expect = 4.225e-12Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 0 Query: 22 AANARERTRMRVLSKAFGRLKLTLPWVPPDTKLSKLDTLRLATSYISHLQRLLSDEE 78 +N +ER R + ++…
BigQuery Meets LLM: Unlocking New Frontiers in AI-Driven Data Analytics | by Said Rasidin | Dec, 2023
In Bigquery we can interact with LLMs using two types, LLM to generate text (using text-bison model) or LLM to generate embedding vectors (use textembedding-gecko) Create a remote model that’s based on the text-bison large language model, and then use that model together with the ML.GENERATE_TEXT function to perform several…
Metagenome analyses identify human endogenous retrovirus-K113 (HML-2) subtype in glioblastoma
. 2023 Dec 15;133(24):e173959. doi: 10.1172/JCI173959. Item in Clipboard Amanda Macamo et al. J Clin Invest. 2023. Show details Display options Display options Format AbstractPubMedPMID . 2023 Dec 15;133(24):e173959. doi: 10.1172/JCI173959. Item in Clipboard Cite Display options Display options Format AbstractPubMedPMID No abstract available Keywords: Brain cancer; Oncology; Virology. PubMed Disclaimer…
Ubuntu Manpage: Bio::EUtilities – BioPerl low-level API for retrieving and storing data from NCBI eUtils
Provided by: libbio-eutilities-perl_1.77-2_all NAME Bio::EUtilities – BioPerl low-level API for retrieving and storing data from NCBI eUtils VERSION version 1.77 SYNOPSIS See Bio::DB::EUtilities for example usage with NCBI. DESCRIPTION This distribution encompasses a low-level API for interacting with (and storing) information from) NCBI’s eUtils interface. See Bio::DB::EUtilities for the query…
No Jitter Roll: Salesforce Improves Einstein, Sprinklr Makes Business More Conversant, Helpshift Adds Multilingual Support
Welcome to this week’s No Jitter Roll, our regular roundup of product news in the communication and collaboration spaces. This week: Salesforce improved the Einstein 1 Platform’s access to different types of data and announced that its Unlimited Edition+ packages are now available. Sprinkler added generative AI to its conversational…
IT/Informatics Job: Bioinformatics Engineer – Pediatric Oncology/Janeway Lab at Dana-Farber Cancer Institute in 450 Brookline Ave, Boston, MA
Responsible for a wide range of technical tasks involving the creation and use of software for the display and manipulation of biological data. Provides assistance to faculty and research staff in the collection, management, analysis and interpretation of biological data, with a focus on the analysis of data from genomic,…
merging replicates
merging replicates 0 This query is regarding ChIP-seq analysis: I have 3 technical replicates for input control and 3 biological replicates for the sample, the paper says to call the peaks independently and take peaks which are common in at least 2 replicates, how should I call peaks independently since…
Importing Data In RStudio: A Step-By-Step Approach
Article Summary Box Recognizing various data types like numeric, integer, and logical in RStudio is essential for accurate data manipulation and import. Effective environment setup, including package installation and global option configuration, is pivotal for streamlined data import processes. Utilizing data.table’s fread function for handling large datasets enhances import efficiency,…
A high-resolution transcriptomic and spatial atlas of cell types in the whole mouse brain
Mouse breeding and husbandry All experimental procedures related to the use of mice were approved by the Institutional Animal Care and Use Committee of the AIBS, in accordance with NIH guidelines. Mice were housed in a room with temperature (21–22 °C) and humidity (40–51%) control within the vivarium of the AIBS…
Alphabet (GOOGL) Enhances Image Generation With Imagen 2 – December 14, 2023
Alphabet’s (GOOGL Quick QuoteGOOGL – Free Report) Google is bolstering its image generation capabilities on the back of generative AI. Google recently launched the second generation of its image generator model, Imagen. Notably, Imagen 2, widely available for Vertex AI customers, offers an improved image quality to help organizations create…
Research on 3D Instance Segmentation part1(Artificial Intelligence Fall ‘23) | by Monodeep Mukherjee | Dec, 2023
SAM-guided Graph Cut for 3D Instance Segmentation(arXiv) Author : Haoyu Guo, He Zhu, Sida Peng, Yuang Wang, Yujun Shen, Ruizhen Hu, Xiaowei Zhou Abstract : This paper addresses the challenge of 3D instance segmentation by simultaneously leveraging 3D geometric and multi-view image information. Many previous works have applied deep learning…
Global Next Generation Sequencing Market Share Projections:
Newark, Dec. 14, 2023 (GLOBE NEWSWIRE) — As per the report published by The Brainy Insights, the global Next Generation Sequencing market is expected to grow from USD 8.26 Billion in 2022 to USD 48.01 Billion by 2032, at a CAGR of 19.24% during the forecast period 2023-2032. NGS has completely…
Charge your APIs Volume 20: Navigating the OpenAPI Initiative Workflows Specification
In the ever-changing world of API development, the OpenAPI Initiative stands as a beacon of standardisation and best practices. This collaborative and open-source project, under the auspices of the Linux Foundation, has been instrumental in establishing the standards for how APIs are described and utilised. Amongst its most notable contributions…
Efficient Ways To Get Help On An R Package In RStudio
Article Summary Box Familiarize yourself with RStudio’s help system, which is essential for efficient programming. Strategies for accessing detailed documentation for specific R packages directly within RStudio. Leverage RStudio’s advanced search features for streamlining the process of finding relevant help information. Interpreting and utilizing package vignettes and manuals, an often-overlooked…
[slurm-users] Slurm versions 23.11.1, 23.02.7, 22.05.11 are now available (CVE-2023-49933 through CVE-2023-49938)
Slurm versions 23.11.1, 23.02.7, 22.05.11 are now available and address a number of recently-discovered security issues. They’ve been assigned CVE-2023-49933 through CVE-2023-49938. SchedMD customers were informed on November 29th and provided a patch on request; this process is documented in our security policy. [1] There are no mitigations available for…
Loading R Packages In RStudio: A Step-By-Step Approach
Article Summary Box Preparing RStudio for package management is pivotal, involving setting up workspace directories and ensuring R version compatibility for optimal package functionality. In Understanding Package Libraries, the intricacies of library paths and package storage locations reveal strategies for streamlined package accessibility and organization. Advanced Techniques for Package Loading…
How to query NCBI to extract Virus fasta files using BioPython?
How to query NCBI to extract Virus fasta files using BioPython? 1 Hi ! I want to extract the genome fasta files of 30 samples automatically using python script from here www.ncbi.nlm.nih.gov/genomes/GenomesGroup.cgi?taxid=10239&host=bacteria. I want the virusus that have has host bacteria and I am using BioPython Package. Entrez.email = “mail”…
Swagger, Help with API Development
Swagger: Revolutionizing REST APIs Introduction Swagger, now known as OpenAPI Specification, has been a game-changer in the world of RESTful APIs. In this post, we’ll explore the history of Swagger, its evolution, current popularity, and its integration with Express.js, a Node.js server-side framework. Additionally, we’ll provide a cheat sheet for…
How to Start Using Google’s Gemini: Is It Free?
Artificial intelligence (AI) technology has been taking giant strides, and one of the most impressive advancements in this field is the Google Gemini AI. Since this is a comparatively new AI model, many people wonder how to start using Google’s Gemini easily. This comprehensive guide will walk you through what…
Why is the number of Minimap2 alignment observations different with CIGAR generation flag?
I am using Minimap2 in Linux to generate a sequence alignment between the Streptomyces coelicolor A3(2) chromosome (ref.fa) and the Mycobacterium tuberculosis chromosome (query.fa). My desired output is a PAF (Pairwise mApping Format) file. The general way to align reference and query sequences with Minimap2 is the following: minimap2 ref.fa…
How does PyTorch Handle GPU Tensors in Statements, Particularly Regarding Memory Exchanges and Debugger Impact?
I have a question about how Python executes statements involving tensors on the GPU. I assume that when Python reaches such a statement, all its parameters should be in the main memory, but most tensors are on the GPU. To my surprise, I noticed that there is no device-to-host exchange…
CEDARS-SINAI Research Bioinformatician II – Human Microbiome Research Institute in Beverly Hills, CA | 889550076
Cedars-Sinai has established a new Human Microbiome Research Institute that will support investigators studying how the microbiome plays a role in human health and disease with key focus areas in: Cancer, Metabolism, Early Life, GI & Liver, and Autoimmunity. The Human Microbiome Research Institute (HMRI) is an innovation hub and…
Query about Atom Index Ordering in GROMACS 2021.0 and 2023.3 – Developers discussions
Lorien December 12, 2023, 10:55am 1 Hello. I am developing a constraint algorithm and primarily working with GROMACS 2021.0. In executions without domain decomposition and with constraints set to all-bonds, the atom indices appear to follow an order similar to that in the PDB file. For instance, in simulations involving…
Data forecasting in R Studio – General
Hi Everyone, I am trying to do forecasting in R Studio however, I ended up getting errors. Could someone help me with the forecasting model in R Studio? Below is the R code: install.packages(“DBI”)install.packages(“odbc”)install.packages(“tidyverse”)install.packages(“forecast”) library(DBI)library(odbc)library(tidyverse)library(forecast) con <- dbConnect(odbc(),driver = “SQL Server”,server = “PRD1”,database = “DUMMY”,trusted_connection = “yes”) query <- “SELECT…
Features Overview – Huma
Huma is a modern, simple, fast & flexible micro framework for building HTTP REST/RPC APIs in Golang backed by OpenAPI 3 and JSON Schema. Pronounced IPA: /’hjuːmɑ/. The goals of this project are to provide: A modern REST or HTTP RPC API backend framework for Go developers Incremental adoption for…
Methylation Analysis Tutorial in R_part1
The code and approaches that I share here are those I am using to analyze TCGA methylation data. At the bottom of the page, you can find references used to make this tutorial. If you are coming from a computer background, please bear with a geneticist who tried to code…
24 OpenAPI Interview Questions and Answers
Introduction: Welcome to our comprehensive guide on OpenAPI interview questions and answers! Whether you’re an experienced developer looking to brush up on your skills or a fresher entering the exciting world of API development, this resource is designed to help you navigate common questions that may arise during an OpenAPI…
ORA with clusterProfiler
Hello everyone, I am trying to do an enrichment analysis of Arabidopsis data, however I am still wondering how to build it or what to use as a background (universe), could you guide me? I am working with this example. diff_genes <- read_delim(file = “differential_genes.tsv”, delim = “\t”) biomartr::organismBM(organism =…
overlapping duplicate dispersed_repeat feature in stringtie
GFF Error: overlapping duplicate dispersed_repeat feature in stringtie 0 Hi. I got following error when I use stringtie. with repeatmasker annotation gff file and RNA-seq bam files which is already sorted with samtools. GFF Error: overlapping duplicate dispersed_repeat feature (ID=461) GFF Error: overlapping duplicate dispersed_repeat feature (ID=712) GFF Error: overlapping…
Best AI Chatbots Heading Into 2024
2023 saw many companies launching AI chatbots to give ChatGPT a run for its money and make a place for themselves in the AI chatbot space, worth $137.6 million this year. The AI chatbot industry is expected to rise by 30% to $179.9 million next year. As we head into…
Calculate Jukes-Cantor, Kimura, Tamura-Nei etc distances from BAM files
Calculate Jukes-Cantor, Kimura, Tamura-Nei etc distances from BAM files 0 Hi, Does anyone know if there’s an existing tool to calculate genetic distances between query and subject sequences in BAMs/SAMs? I’m reasonably sure it’s possible to identify transitions and transversions using data from the MD flag and the sequence, and…
Introduction | Kubb
Hi 👋🏽 and welcome to Kubb! My name is Stijn Van Hulle, the creator of Kubb and I’m super excited to have you here! Let me give you a quick introduction to Kubb and what it can do for your project. 💡 What is Kubb Kubb is a library…
The most effective Schema-Driven Development using OpenAPI for Logistic Engineer
In web application development, your team use OpenAPI document in many cases When you separate backend and frontend. But, the API specification document based on OpenAPI is written in yaml or json format. Then it is a very stressful task. Also, writing up the API document doesn’t mean completing by…
python – Questioning a SQL database that contains doc chunks with keywords using vertex ai
Hello Stack Overflow Community, I am working on a project using Google Cloud services, specifically a Vertex AI Python notebook, and I need help with querying a PostgreSQL database to find the most similar text documents compared to a given keyword. The database contains chunks of text documents that were…
r – Fst calculation from VCF files
I have four vcf files, SNPs_s1.vcf, SNPs_s2.vcf, SNPs_s3.vcf, and SNPs_s4.vcf, which contain information about SNPs. These vcf files were obtained by using the following methods: the initial input files were short-paired reads I did mapping with minimap2 ./minimap2 -ax sr ref.fa read1.fq.gz read2.fq.gz > aln.sam converted to bam file samtools…
vcfdist: accurately benchmarking phased small variant calls in human genomes
The affine gap design space for selecting variant representations As demonstrated in Fig. 1, the main issue with a difference-based format such as VCF is that often there are multiple reasonable sets of variant calls that can be used to represent the same final sequence relative to a reference FASTA. Since…
Between 3.51 Crores to 4 Crores Properties for Sale in Phase 3, Delhi – NoBroker
Filters Premium FiltersNew BHK Type 1 RK 1 BHK 2 BHK 3 BHK 4 BHK 4+ BHK Price Range: ₹ 0 to ₹ 10 Cr Showing properties near your searched localities Didn’t find what you are looking for? Explore nearby localities or Post Your Requirement and we will send an…
Build a Public tRPC API: trpc-openapi vs ts-rest
When we decided to build a public-facing API at Documenso, we had to choose between creating a new application from scratch or using the existing codebase. The first option meant building the API with a technology like Node.js, for example, and launching it under a new, separate domain. The API…
DE Jobs – Elevance Health Business Information SQL / RStudio Developer in MIAMI, Florida, United States
WARNING: Please beware of phishing scams that solicit interviews or promote work-at-home opportunities, some of which may pose as legitimate companies. Elevance Health requires a completed online application for consideration of employment for any position. We will never ask you for a credit card, send you a check, or ask…
CIGAR and query sequence lengths differ
I am developing a program that softclips reads. When I run samtools view the_new_bam_created_with_my_softclipped_read.bam I get this error message MN01972:51:000H5KYKL:1:11101:10749:1220 0 chr2 208248363 60 24S77M25S * 0 0 CAAAATCACATTATTGCCAACATGACTTACTTGATCCCCATAAGCATGACGACCTATGATGATAGGTTTTACCCATCCACTCACAAGCCGGGGGATATTTTTGCAGATAATGGCTTCTCTGAAGAC AFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF[E::bam_read1] CIGAR and query sequence lengths differ for MN01972:51:000H5KYKL:1:11101:10753:13456 FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFAFFFFFFFFFFFFFFFFFFFFF MD:Z:126 RG:Z:230824_MN01972_0051_A000H5KYKL_RACP1_4poolv7anddirect_A NM:i:0 UQ:i:0 AS:i:126 MN01972:51:000H5KYKL:1:11101:10753:13456 0 chr2 208248339 60 111M2D13M…
Turn customer feedback into opportunities using generative AI in BigQuery DataFrames
To operate a thriving business, it is important to have a deep understanding of your customers’ needs and extract valuable insights from their feedback. However, the journey of extracting actionable information from customer feedback is a formidable task. Examining and categorizing feedback can help you discover your customers’ core pain…
How to group atoms as molecules in reax – LAMMPS General Discussion
Using Aug 2023 version of Lammps This is a rather basic issue. I am following the paper by Kim to model , water, ethahol and phosphoric acid adsorbed to TiO2 using their ff.Reactive MD-force field: Kim, S.-Y., van Duin, A. C. T., and Kubicki, J. D., 2012, Molecular dynamics simulations…
Knime updates analytics platform with new GenAI capabilities
New generative AI features highlight the latest Knime analytics platform update, including improved responses from the vendor’s chatbot. In addition, Knime Analytics Platform 5.2 — launched on Dec. 7 and now generally available — features support for Azure OpenAI Service from Microsoft and a new UI aimed at making…
sparklyr – Databricks Connect v2
Last updated: Thu Dec 7 16:28:19 2023 Intro Databricks Connect enables the interaction with Spark clusters remotely. It is based on Spark Connect, which enables remote connectivity thanks to its new decoupled client-server architecture. This allows users to interact with the Spark cluster without having to run the jobs from…
What I Learned In 48 Hours
AWS Reinvent 2023 took over the Las Vegas Strip. Free image from Pixabay During my recent visit to Las Vegas for the Amazon Web Services re:Invent conference, I was struck by the vibrancy and energy of the event. In a year full of significant developments in the tech world, AWS…
Business Information SQL / RStudio Developer, CHICAGO, IL + 29 more locations
Description Business Information SQL / RStudio Developer Location: .This position will work a hybrid model (remote and office). The Ideal candidate will live within 50 miles of one of our Elevance Health PulsePoint locations. Preferred Location: Chicago, IL. The Business Information SQL / RStudio Developer is…
How to query 1000 genomes project VCF files for specific regions without downloading whole chromosomes first?
How to query 1000 genomes project VCF files for specific regions without downloading whole chromosomes first? 2 Hi, I am trying to find a way to extract an arbitrary region of human genome from the 1000 genomes project’s VCF files without having to download the genome or individual chromosome files…
How to properly mock a (Pysam) read
I am creating a custom softclipping tool due to a limitation found in Ampliconclip Issue softclipping reads when they belong and don’t belong to a common amplicon. I am progressing ok in my development and I am developing tests. I found some limitations when I try to mock a Pysam…
Fully Automated NGS Sample Preparation Using a Digital Microfluidics Platform
Hello everyone, and thank you for attending Lab Managers Automation Digital Summit. My name is Mary Beth DiDonna and I’ll be moderating this discussion. Welcome to this session, fully automated NGS sample preparation using a digital microfluidics platform. The Miro NGS Prep System is a compact digital microfluidics platform, which…
[slurm-users] Time spent in PENDING/Priority
We use Prometheus as our primary metric tool, and I recently added a metric for jobs in PENDING for the specific reason of “priority”. So we’ll have some nice data for when we are preparing for FY 2025, I suppose, the problem is for this past year we are stuck…
get gene name from rsID
get gene name from rsID 1 I’ve got a list of rs IDs in xlsx format. I need to get the gene name for each rsID. When I use this command, I get the gene name esearch -db snp -query “rs573455” | esummary | xtract -pattern GENE_E -element NAME |…
Anaplastic Large Cell Lymphoma Therapeutics Market Research Report Provides thorough Industry Overview, which offers an In-Depth Analysis of Product T
Market Overview and Report Coverage Anaplastic Large Cell Lymphoma (ALCL) is a rare type of non-Hodgkin lymphoma that primarily affects the lymph nodes and skin. It is characterized by the abnormal growth of large cells called anaplastic lymphoma kinase (ALK)-positive or ALK-negative lymphoma cells. The ALCL therapeutics market pertains to…
Google Launches Its ‘Largest And Most Capable’ AI Model Gemini To Compete With ChatGPT
Topline Google launched a pared-down version of what it calls its “largest and most capable” AI model, Gemini, in its AI chatbot Bard on Wednesday, while the most advanced version of Gemini is expected in 2024—adding fuel to the race among tech giants to lead AI development. A pared-down version…
Some of the Big 4 consulting giants already think AI could trim years off the path to partner
Consulting giants and law firms are looking to artificial intelligence to speed up the time it takes junior staffers to make it to the prestigious partner level as the technology eliminates vast swaths of the repetitive, time-consuming tasks that typically filled up their first few years on the job. At…
Issues while running blastx
Issues while running blastx 1 Hi, I face this problem when I run blastx command in linux. blastx -db ~/Downloads/uniprot_sprot.dat -query ../../../trinity_out_dir.Trinity.fasta -num_threads 2 -max_target_seqs 1 -outfmt 6 > balstx.outfmt6 Warning: [blastx] Examining 5 or more matches is recommended BLAST Database error: No alias or index file found for protein…
Global DNA Sequencing Equipment Market Trend And Analysis
DNA Sequencing Equipment Market Size And Overview The competitive landscape, market drivers and challenges, and current market trends are all thoroughly examined in our report on the global DNA Sequencing Equipment Market. In addition to offering a realistic assessment of the market’s size and future growth potential, this report offers…
megablast taxonomy assign in blobtools
megablast taxonomy assign in blobtools 0 I made taxonomy assignment file using megablast and ran blobtools create, view, plot. However I couldn’t get any taxonmy assignment in the plot, there is only undefined. How can I get bacterial information ? $blastn -task megablast -db ${nrdb} -query scaffold$i.fa -outfmt ‘6 qseqid…
Specify both file content and body content in open…
In my web application, when I create a form-data object that looks like the following: let fd = new FormData();let data = {};data.id = 5; // thing id, if this is an existing thingdata.thingName=”Resource Test”; // actual value from modal formdata.thingType=”Type Check”; // actual value from modal formdata.relatedThingId =…
GPT Model Behind the Scene Exploring it from scratch with Pytorch by Chee Kean Artificial
GPT Model Behind the Scene: Exploring it from scratch with Pytorch CheeKean · Follow Published in Artificial Intelligence in Plain English 18 min read · Apr 22 Listen Share More Discover the intricacies of building and exploring a GPT model from scratch with an in-depth explanation that covers technical details…
AssemblyMAFFromAnchorWavePlugin IndexOutOfBoundsException
AssemblyMAFFromAnchorWavePlugin IndexOutOfBoundsException 0 Hello, I’m attempting to create a test database with a smaller genome just to confirm I can get the pipeline running. I’m using PHG 1.8 with singularity. I was able to successfully run MakeDefaultDirectoryPlugin, CreateValidIntervalsFilePlugin, and MakeInitialPHGDBPipelinePlugin. Running AssemblyMAFFromAnchorWavePlugin yields an “IndexOutOfBoundsException” error, but the cause is…
Digital PCR (dPCR) and Quantitative PCR (qPCR) Market Size & Share to Surpass USD 7.5 billion by 2031
Transparency Market Research Growing emphasis on robust data analysis tools and software enhances the utility of dPCR and qPCR platforms, enabling efficient interpretation and utilization of complex molecular data. Wilmington, Delaware, United States, Dec. 04, 2023 (GLOBE NEWSWIRE) — Transparency Market Research Inc. – The global digital PCR (dPCR) and…
Microbial gene coverage from blast result
Microbial gene coverage from blast result 0 Hello all I am new to BLAST and Biostars. I have removed human-mapped reads from RNA-Seq data and did Kraken2 and Bracken analysis using the microbial reads. Using the Kraken Tool, I retrieved the microbial reads. Then I performed BLASTx in order to…
Sports is only starting to imagine, and experience, the capabilities of generative AI. Will organizations bear the cost?
The PGA Tour demonstrated its generative AI virtual assistant at the Pro Am for Amazon’s re:Invent event in Las Vegas in late November. A video clip was generated after the AI assistant answered a question. Then the player would attempt to replicate the shot.Amazon The introduction of ChatGPT a year…
How to resolve the error of protein lacking a stop codon when using GenomeThreader for homology prediction?
How to resolve the error of protein lacking a stop codon when using GenomeThreader for homology prediction? 0 Dear all,the error message and running process are as follows. Thank you for your answers. makeblastdb -in pudorinus.fa -parse_seqids -dbtype nucl -out index/pu& nohup tblastn -query all.pep.fa -out pu.blast -db index/pu -outfmt…
BLAST: overflow error
Hi, I’m using blastn in BLAST 2.11.0 and it keeps failing for specific sequences for a reason that I’m yet to understand. Any lead on what he problem might be? The error message is Error: NCBI C++ Exception: T0 “/tmp/BLAST/2.11.0/gompi-2020b/ncbi-blast-2.11.0+-src/c++/src/serial/objistrasnb.cpp”, line 499: Error: (CSerialException::eOverflow) byte 132: overflow error ( at…
Understanding gene level copy number data from TCGAbiolinks
Hi all. Thanks in advance for helping me out. I’m trying to analyze copy number data from TCGA (using TCGAbiolinks), and trying to define genes that are either amplified or deleted. To download gene level copy number alteration, I used the code below: query <- GDCquery(project=”TCGA-BRCA”, data.category = ‘Copy Number…
How to Install autodock-vina software package in Ubuntu 16.04 LTS (Xenial Xerus)
How to Install autodock-vina software package in Ubuntu 16.04 LTS (Xenial Xerus) autodock-vina software package provides docking of small molecules to proteins, you can install in your Ubuntu 16.04 LTS (Xenial Xerus) by running the commands given below on the terminal, $ sudo apt-get update $ sudo apt-get install autodock-vina…
How to configure GCP Private Service Access (from vpc, aws) | by Derek.Kim | Dec, 2023
GCP Private Service Access (PSA) is one of the private access options provided by the Google Cloud Platform (GCP) that allows you to securely control and restrict network connections to specific Google services or 3rd party services. Private Service Access provides private access to certain Google services that support private…
PDBe CCDUtils: an RDKit-based toolkit for handling and analysing small molecules in the Protein Data Bank | Journal of Cheminformatics
The Protein Data Bank (PDB) [1], managed by the worldwide PDB (wwPDB) consortium [2], serves as the single global repository for information on 3D structures of proteins, nucleic acids, and complex assemblies. With over 200,000 entries as of July 2023, about 75% of these structures contain at least one small…
How AI Can Spark Organizational Change
AI is more than a technical innovation. It’s a mindset that leading companies are using to transform their organizations. Businesses that take the lead in this emerging era of AI will be able to better use the technology to solve critical issues and mitigate potential operational bottlenecks. Here are some…