Tag: RNA

Ribosomal RNA (rRNA) meaning and definition in microbiology terminology

          Ribosomal RNA (rRNA)   The following texts are the property of their respective authors and we thank them for giving us the opportunity to share for free to students, teachers and users of the Web their texts will…

Continue Reading Ribosomal RNA (rRNA) meaning and definition in microbiology terminology

Bioinformatics Engineer Job Opening in St. Louis, MO at Benson Hill

About Benson HillBenson Hill empowers innovators to develop more healthy, tasty and sustainable food by unlocking the natural genetic diversity of plants. Benson Hill’s CropOS™ platform combines machine learning and big data with advanced breeding techniques and plant biology to drastically accelerate and simplify the product development process. The CropOS…

Continue Reading Bioinformatics Engineer Job Opening in St. Louis, MO at Benson Hill

Construction of a circRNA-miRNA-mRNA Regulated Pathway Involved in EGFR-TKI Lung Adenocarcinoma Resistance

1 Introduction Lung cancer is the leading cause of cancer-related deaths worldwide, with adenocarcinoma as the most common histological subtype.1 In recent years, epidermal growth factor receptor-tyrosine kinase inhibitors (EGFR-TKIs), such as gefitinib (first generation) and osimertinib (third generation), have been widely used for lung adenocarcinoma patients harboring activated EGFR…

Continue Reading Construction of a circRNA-miRNA-mRNA Regulated Pathway Involved in EGFR-TKI Lung Adenocarcinoma Resistance

UCL-BLIC/rnaseq – Giters

Introduction UCL-BLIC/rnaseq is a bioinformatics analysis pipeline used for RNA sequencing data, modified to add kallisto. The workflow processes raw data from FastQ inputs (FastQC, Trim Galore!), aligns the reads (STAR or HiSAT2), generates gene counts (featureCounts, StringTie) as well as kallisto abundance files, and performs extensive quality-control on the…

Continue Reading UCL-BLIC/rnaseq – Giters

which value is selected for pearson correlation for cis and trans target gene prediction ?

which value is selected for pearson correlation for cis and trans target gene prediction ? 1 I want to analyses the cis and trans target gene from the RNA-seq data. i had read several paper and it shows that either PCC or spearman’s correlation is used for finding the cis…

Continue Reading which value is selected for pearson correlation for cis and trans target gene prediction ?

Novel role of the dietary flavonoid fisetin in suppressing rRNA biogenesis

The nucleolus of a cell is a critical cellular compartment that is responsible for ribosome biogenesis and plays a central role in tumor progression. Fisetin, a nutraceutical, is a naturally occurring flavonol from the flavonoid group of polyphenols that has anti-cancer effects. Fisetin negatively impacts several signaling pathways that support…

Continue Reading Novel role of the dietary flavonoid fisetin in suppressing rRNA biogenesis

Novel role of the dietary flavonoid fisetin in suppressing rRNA biogenesis

The nucleolus of a cell is a critical cellular compartment that is responsible for ribosome biogenesis and plays a central role in tumor progression. Fisetin, a nutraceutical, is a naturally occurring flavonol from the flavonoid group of polyphenols that has anti-cancer effects. Fisetin negatively impacts several signaling pathways that support…

Continue Reading Novel role of the dietary flavonoid fisetin in suppressing rRNA biogenesis

ASM1330234v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::02/18/2020 23:45:10 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::4.11 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::4,261 CDSs (total)::4,181 Genes (coding)::4,013 CDSs (with protein)::4,013 Genes (RNA)::80 rRNAs::2, 9, 1 (5S, 16S, 23S) complete rRNAs::2 (5S) partial…

Continue Reading ASM1330234v1 – Genome – Assembly

Immune cell – ANGPTL8 – The Human Protein Atlas

ANDNOT FieldAllGene nameProtein classUniprot keywordChromosomeExternal idTissue expression (IHC)Patient ID (IHC)Tissue category (RNA)Tissue expression cluster (RNA)Reliability score tissue (IHC)Brain region category (RNA)Mouse brain category (RNA)Pig brain category (RNA)Reliability score mouse brainCell type category (RNA)Single cell type expression cluster (RNA)Cell type enrichment (RNA)Prognostic cancerCancer category (RNA)Immune cell category (RNA)Immune cell lineage category…

Continue Reading Immune cell – ANGPTL8 – The Human Protein Atlas

Dry Lab Manager – Bioinformatics by Gold Group in Oxford, Oxfordshire Ref: 215263025

Dry Lab Manager – Bioinformatics Role My client is a biotechnology company developing RNA medicines. They are looking for a Dry Lab Manager for a growing Bioinformatics team. Ideally you will have a background in Bioinformatics and love all things tech including hardware, software, cloud, data and security. The Dry…

Continue Reading Dry Lab Manager – Bioinformatics by Gold Group in Oxford, Oxfordshire Ref: 215263025

The mtDNA mutation spectrum in the PolG mutator mouse reveals germline and somatic selection | BMC Genomic Data

1. Taylor RW, Turnbull DM. Mitochondrial DNA mutations in human disease [Internet]. Vol. 6, Nature Reviews Genetics. Europe PMC Funders; 2005 [cited 2020 Aug 21]. p. 389–402. Available from: /pmc/articles/PMC1762815/?report=abstract. 2. Kabunga P, Lau AK, Phan K, Puranik R, Liang C, Davis RL, Sue CM, Sy RW Systematic review of…

Continue Reading The mtDNA mutation spectrum in the PolG mutator mouse reveals germline and somatic selection | BMC Genomic Data

ASM323668v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::01/22/2018 12:47:20 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline Annotation Method::Best-placed reference protein set; GeneMarkS+ Annotation Software revision::4.3 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::2,832 CDS (total)::2,788 Genes (coding)::2,717 CDS (coding)::2,717 Genes (RNA)::44 rRNAs:: complete rRNAs:: partial rRNAs:: tRNAs::40 ncRNAs::4 Pseudo Genes (total)::71 Pseudo Genes…

Continue Reading ASM323668v1 – Genome – Assembly

Treat time variable as continuous or discrete?

Hello, I have two questions regarding an RNA-seq experiment with 10 time points and 20 replicates per time point. So far I’ve run an LRT using the following models: design = ~ timepoint reduced = ~ 1 Throughout the experiment, RNA was extracted at days 3, 4, 15, 16, 44,…

Continue Reading Treat time variable as continuous or discrete?

RNAseq analysis of treatment-dependent signaling changes during inflammation in a mouse cutaneous wound healing model

Background: Despite proven therapeutic effects in inflammatory conditions, the specific mechanisms of phytochemical therapies are not well understood. The transcriptome effects of Traumeel (Tr14), a multicomponent natural product, and diclofenac, a non-selective cyclooxygenase (COX) inhibitor, were compared in a mouse cutaneous wound healing model to identify both known and novel…

Continue Reading RNAseq analysis of treatment-dependent signaling changes during inflammation in a mouse cutaneous wound healing model

Pulmonary Infection Revealed by Metagenomic NGS

1Department of Biomedical Engineering, College of Life Science and Bioengineering, Beijing University of Technology, Beijing, People’s Republic of China; 2Department of Clinical Laboratory, Beijing Capitalbio Medlab, Beijing, People’s Republic of China Background: Treatment of pulmonary infections in the intensive care unit (ICU) represents a great challenge, especially infections caused by…

Continue Reading Pulmonary Infection Revealed by Metagenomic NGS

ASM207889v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI RefSeq Annotation Date::03/13/2021 00:37:40 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::5.1 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::2,786 CDSs (total)::2,700 Genes (coding)::2,423 CDSs (with protein)::2,423 Genes (RNA)::86 rRNAs::7, 6, 6 (5S, 16S, 23S) complete rRNAs::7, 6,…

Continue Reading ASM207889v1 – Genome – Assembly

SMAD4 target genes are part of a transcriptional network that integrates the response to BMP and SHH signaling during early limb bud patterning

. 2021 Nov 25;dev.200182. doi: 10.1242/dev.200182. Online ahead of print. Affiliations Expand Affiliations 1 Developmental Genetics, Department of Biomedicine, University of Basel, 4058 Basel, Switzerland. 2 Functional Genomics Department, Lawrence Berkeley National Laboratory, Berkeley, CA 94720, USA. 3 U.S. Department of Energy Joint Genome Institute, Walnut Creek, CA 94598, USA….

Continue Reading SMAD4 target genes are part of a transcriptional network that integrates the response to BMP and SHH signaling during early limb bud patterning

The Chloranthus sessilifolius genome provides insight into early diversification of angiosperms

1. The Plant List. The Plant List—A Working List of All Plant Species (Royal Botanic Gardens, Kew and Missouri Botanical Garden, 2019). www.theplantlist.org/. Retrieved 20 Aug 2019. 2. Christenhusz, M. J. M. & Byng, J. W. The number of known plants species in the world and its annual increase. Phytotaxa…

Continue Reading The Chloranthus sessilifolius genome provides insight into early diversification of angiosperms

Enlarging windows into understanding gene functions

Credit: Pixabay/CC0 Public Domain In a text file, the rows of letters A, T, C and G appearing over and over in a dizzying array of combinations, are unremarkable, save perhaps for the absence of all the other letters of the alphabet. Yet the specific sequence of these four letters…

Continue Reading Enlarging windows into understanding gene functions

corral: Single-cell RNA-seq dimension reduction, batch integration, and visualization with correspondence analysis

Abstract Effective dimension reduction is an essential step in analysis of single cell RNA-seq(scRNAseq) count data, which are high-dimensional, sparse, and noisy. Principal component analysis (PCA) is widely used in analytical pipelines, and since PCA requires continuous data, it is often coupled with log-transformation in scRNAseq applications. However, log-transformation of…

Continue Reading corral: Single-cell RNA-seq dimension reduction, batch integration, and visualization with correspondence analysis

vanheeringen-lab/seq2science – Giters

Seq2science is the attempt of the van heeringen lab to generate a collection of generic pipelines/workflows which can be used by complete beginners to bioinformatics and experienced bioinformaticians alike. Please take a look at our docs for help with installation, how to run it, and best practices. Our supported workflows:…

Continue Reading vanheeringen-lab/seq2science – Giters

DESeq2 input file from featureCount

DESeq2 input file from featureCount 0 Hello. I am analysing RNA-Seq data for 8 samples (2 treatments, 4 repetition each). I just finished the gene count using featureCount (Subread). How do I generate a matrix to use on DeSeq2 from the files (.RDS) genereted from featureCount? Do I just create…

Continue Reading DESeq2 input file from featureCount

Large difference in mean reads per cell from cellranger and nCount_RNA from Seurat, is it a problem?

Large difference in mean reads per cell from cellranger and nCount_RNA from Seurat, is it a problem? 0 I have single cell RNA-seq from PBMCs. Cellranger gives a mean reads per cell by dividing the total number of reads by the estimated number of cells. After loading into Seurat I…

Continue Reading Large difference in mean reads per cell from cellranger and nCount_RNA from Seurat, is it a problem?

STAR alignment in a full directory

STAR alignment in a full directory 0 Hi! I’m working with STAR and I would like to align multiple file, but separately. I have file paires like these two: Dros_01_S48_L001_R1_001.fastq.gz Dros_01_S48_L001_R2_001.fastq.gz etc. Only the S[number] changes and the R1 and R2 in the names. I have a code, what I…

Continue Reading STAR alignment in a full directory

Two divergent haplogroups of a sacsin-like gene in Acropora corals

Verification of coding sequence (CDS) of a sacsin-like gene The genomic assembly version 2.01 of A. millepora13 was downloaded from the web site (przeworskilab.com/acropora-millepora-genome/). RNA-seq reads of one A. millepora (accession: SRR2086157) were mapped (similarity fraction > 0.8, length fraction > 0.9) to the genome assembly using CLC Genomics Workbench (www.qiagenbioinformatics.com/). Mapping results were…

Continue Reading Two divergent haplogroups of a sacsin-like gene in Acropora corals

Benchmarking different approaches for Norovirus genome assembly in metagenome samples

Background: Genome assembly of viruses with high mutation rates, such as Norovirus and other RNA viruses, or from metagenome samples, poses a challenge for the scientific community due to the coexistence of several viral quasispecies and strains. Furthermore, there is no standard method for obtaining whole-genome sequences in non-related patients….

Continue Reading Benchmarking different approaches for Norovirus genome assembly in metagenome samples

Job: BBRC – Bioinformatics Methodologist

JOB DESCRIPTION Designation: Senior Research Investigator Position: Bioinformatics Methodologist Job Location: Bangalore Department: Informatics and Predictive Sciences (BBRC-IPS) About Syngene Incorporated in 1993, Syngene International Ltd. is an innovation-focused global discovery, development and manufacturing organization providing integrated scientific services to the pharmaceutical, biotechnology, nutrition, animal health, consumer goods and specialty…

Continue Reading Job: BBRC – Bioinformatics Methodologist

Postdoctoral Researcher in Plant-Virus Interactions (nr 1)

Category Research / Academic Location Amsterdam Are you a skilled researcher in Plant biology, and intrigued by how plant viruses manipulate their host? We are now seeking a postdoctoral researcher for an ambitious proteomics project on plant viruses. At the University of Amsterdam (UvA), we study how RNA viruses interact with…

Continue Reading Postdoctoral Researcher in Plant-Virus Interactions (nr 1)

Aldehyde-driven transcriptional stress triggers an anorexic DNA damage response

This article was originally published here Nature. 2021 Nov 24. doi: 10.1038/s41586-021-04133-7. Online ahead of print. ABSTRACT Endogenous DNA damage can perturb transcription, triggering a multifaceted cellular response that repairs the damage, degrades RNA polymerase II and shuts down global transcription1-4. This response is absent in the human disease Cockayne…

Continue Reading Aldehyde-driven transcriptional stress triggers an anorexic DNA damage response

High-Throughput RNA Sequencing Reveals the Effect of NB-UVB

Introduction Psoriasis vulgaris, major chronic immune-mediated skin disease, affects 1–3% of the adult population worldwide.1 Psoriasis is one of the major complex skin diseases that is significantly linked to genetic predisposition, major histocompatibility alleles, and environmental factors.2 Over the past few years, the cellular and molecular contributions to psoriasis were…

Continue Reading High-Throughput RNA Sequencing Reveals the Effect of NB-UVB

ASM960013v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::10/31/2019 21:03:28 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::4.10 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::5,430 CDSs (total)::5,359 Genes (coding)::5,211 CDSs (with protein)::5,211 Genes (RNA)::71 rRNAs::2, 4, 3 (5S, 16S, 23S) complete rRNAs::2 (5S) partial…

Continue Reading ASM960013v1 – Genome – Assembly

Duplication in DNA-seq vs RNA-seq

Duplication in DNA-seq vs RNA-seq 1 Why is duplication a greater concern in DNA-seq than RNA-seq? Duplication • 95 views Because in RNA-seq, it is normal to have what we call biological duplicates. These are reads with exactly the same sequence whose origin takes root in the original RNA extract,…

Continue Reading Duplication in DNA-seq vs RNA-seq

Functional metagenomic profile of the lacrimal sac microbial communities in primary acquired nasolacrimal duct obstruction: The Lacriome paper 2

Purpose: To study the functional metagenomic profile of the microbes isolated from the lacrimal sac of patients with primary acquired nasolacrimal duct obstruction. Methods: A prospective study was performed on 10 consecutive lacrimal sac samples obtained for the metagenomic analysis from patients with primary acquired nasolacrimal duct obstruction ( who…

Continue Reading Functional metagenomic profile of the lacrimal sac microbial communities in primary acquired nasolacrimal duct obstruction: The Lacriome paper 2

Applied Materials hiring Bioinformatics Scientist in Bengaluru, Karnataka, India

RoleWe are seeking highly motivated individuals to be a part of an expanding team of engineers, computational biologists and bioinformatics scientists as we build the next-generation molecular imaging platforms for research, pharmaceutical development and clinical science. In this role, you will develop and integrate workflows related to spatial transcriptomics and…

Continue Reading Applied Materials hiring Bioinformatics Scientist in Bengaluru, Karnataka, India

Chromosome-scale genome assembly of the high royal jelly-producing honeybees

1. Knecht, D. & Kaatz, H. H. Patterns of larval food production by hypopharyngeal glands in adult worker honey bees. Apidologie 21, 457–468, doi.org/10.1051/apido:19900507 (1990). Article  Google Scholar  2. Kamakura, M. Royalactin induces queen differentiation in honeybees. Nature 473, 478–483, doi.org/10.1038/nature10093 (2011). ADS  CAS  Article  PubMed  Google Scholar  3. Ramadan,…

Continue Reading Chromosome-scale genome assembly of the high royal jelly-producing honeybees

empty fastq files created by docker bcl2fastq2 v2.20 OSX

empty fastq files created by docker bcl2fastq2 v2.20 OSX 0 HI, I installed a following docker image, REPOSITORY TAG IMAGE ID CREATED SIZE zymoresearch/bcl2fastq latest 037f216c2523 13 months ago 117MB and run a following command; docker run -d –name bcl2fastq -v /Volumes/Aura2/bcl_NU/170720_NB501488_0132_AH5V32BGX3:/mnt/run -v /Volumes/Aura2/output:/mnt/out zymoresearch/bcl2fastq:2.20 -R /mnt/run -o /mnt/out/Data/Intensities/BaseCalls/Alignment_1 –barcode-mismatches…

Continue Reading empty fastq files created by docker bcl2fastq2 v2.20 OSX

From DNA sequences to microbial ecology: Wrangling NEON soil microbe data with the neonMicrobe R package – Qin – 2021 – Ecosphere

Introduction Microbial life on earth is ubiquitous and essential in critical ecosystem processes (Cavicchioli et al. 2019). Soils are among the most diverse microbial habitats known, and recent surveys at continental (Fierer et al. 2012, Ladau et al. 2013, Talbot et al. 2014, Prober et al. 2015, Thompson et al. 2017, Wang et al. 2018) and global…

Continue Reading From DNA sequences to microbial ecology: Wrangling NEON soil microbe data with the neonMicrobe R package – Qin – 2021 – Ecosphere

TANK prevents IFN-dependent fatal diffuse alveolar hemorrhage by suppressing DNA-cGAS aggregation

Abstract Diffuse alveolar hemorrhage (DAH) is one of the serious complications associated with systemic lupus erythematosus, an autoimmune disease whose pathogenesis involves type I IFNs and cytokines. Here, we show that TANK, a negative regulator of the NF-κB signaling via suppression of TRAF6 ubiquitination, is critical for the amelioration of…

Continue Reading TANK prevents IFN-dependent fatal diffuse alveolar hemorrhage by suppressing DNA-cGAS aggregation

Aspergillus fumigatus pan-genome analysis identifies genetic variants associated with human infection

1. Latgé, J. P. and Chamilos, G. Aspergillus fumigatus and Aspergillosis in 2019. Clin. Microbiol. Rev. doi.org/10.1128/CMR.00140-18 (2019). 2. Invasive Aspergillosis. LIFE www.life-worldwide.org/fungal-diseases/invasive-aspergillosis (2020). 3. Harrison, N. et al. Incidence and characteristics of invasive fungal diseases in allogeneic hematopoietic stem cell transplant recipients: a retrospective cohort study. BMC Infect. Dis….

Continue Reading Aspergillus fumigatus pan-genome analysis identifies genetic variants associated with human infection

ASM402823v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI RefSeq Annotation Date::11/09/2020 11:04:02 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::4.13 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::3,015 CDSs (total)::2,958 Genes (coding)::2,817 CDSs (with protein)::2,817 Genes (RNA)::57 rRNAs::2, 2, 2 (5S, 16S, 23S) complete rRNAs::2, 2,…

Continue Reading ASM402823v1 – Genome – Assembly

ASM197595v2 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI RefSeq Annotation Date::01/19/2021 11:22:08 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::5.0 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::2,922 CDSs (total)::2,866 Genes (coding)::2,843 CDSs (with protein)::2,843 Genes (RNA)::56 rRNAs::2, 2, 2 (5S, 16S, 23S) complete rRNAs::2, 2,…

Continue Reading ASM197595v2 – Genome – Assembly

Immune cell – EPCAM – The Human Protein Atlas

ANDNOT FieldAllGene nameProtein classUniprot keywordChromosomeExternal idTissue expression (IHC)Patient ID (IHC)Tissue category (RNA)Tissue expression cluster (RNA)Reliability score tissue (IHC)Brain region category (RNA)Mouse brain category (RNA)Pig brain category (RNA)Reliability score mouse brainCell type category (RNA)Single cell type expression cluster (RNA)Cell type enrichment (RNA)Prognostic cancerCancer category (RNA)Immune cell category (RNA)Immune cell lineage category…

Continue Reading Immune cell – EPCAM – The Human Protein Atlas

Nucleic Acids Research Papers on OncoDB, mBodyMap, Genomicus

Researchers at the University of Illinois at Chicago and Washington University describe an online database called OncoDB, designed for analyzing large cancer datasets to detect gene expression shifts and viral infections with potential ties to cancer, such as human papillomavirus. The current version of the resource contains data for more…

Continue Reading Nucleic Acids Research Papers on OncoDB, mBodyMap, Genomicus

rlmC expression plasmid | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC

Description Catalyzes the formation of 5-methyl-uridine at position 747 (m5U747) in 23S rRNA. Family Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA M5U methyltransferase family. RlmC subfamily. Species Escherichia coli (strain K12 / DH10B) Sequence MQCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLADFPVEEWCAPVSGPEQGFRNKAKMVVSGSVEKPLLGMLHRDGTPEDLCDCPLYPASFAPVFAALKPFIARAGLTPYNVARKRGELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQLKVITVNIQPVHMAIMEGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYATARDWVRQLPVKHMWDLFCGVGGFGLHCATPDMQLTGIEIASEAIACAKQSAAELGLTRLQFQALDSTQFATAQGDVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVKQ SDS-PAGE (Note: Representative image – actual molecular weight may vary depending on tag…

Continue Reading rlmC expression plasmid | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC

ASM344421v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::04/16/2018 10:19:40 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline Annotation Method::Best-placed reference protein set; GeneMarkS+ Annotation Software revision::4.5 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::1,551 CDS (total)::1,516 Genes (coding)::1,452 CDS (coding)::1,452 Genes (RNA)::35 tRNAs::33 ncRNAs::2 Pseudo Genes (total)::64 Pseudo Genes (ambiguous residues)::0 of 64 Pseudo…

Continue Reading ASM344421v1 – Genome – Assembly

Bioinformatics Analysis

News:Bioinformatics Analysis 0 Increasingly, bioinformatics analysis is a bottleneck in the research process. Datasets continue to grow in size and complexity and typically require the intelligent use of many different tools to be queried effectively. With competitive rates, our skilled Data Analysis group are able to help move your bioinformatics…

Continue Reading Bioinformatics Analysis

ASM588728v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::01/04/2018 12:18:59 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline Annotation Method::Best-placed reference protein set; GeneMarkS+ Annotation Software revision::4.3 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::4,334 CDS (total)::4,229 Genes (coding)::4,072 CDS (coding)::4,072 Genes (RNA)::105 rRNAs::2, 1, 1 (5S, 16S, 23S) complete rRNAs::2, 1, 1 (5S, 16S,…

Continue Reading ASM588728v1 – Genome – Assembly

ASM880148v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::09/26/2019 17:44:56 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::4.9 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::4,867 CDSs (total)::4,786 Genes (coding)::4,681 CDSs (with protein)::4,681 Genes (RNA)::81 rRNAs::8, 3, 1 (5S, 16S, 23S) complete rRNAs::7, 1, 1…

Continue Reading ASM880148v1 – Genome – Assembly

10 Things to Be Thankful for in 2021

Following on the annus horribilus of 2020, expectations for 2021 were high (or maybe, low). Surely we would emerge from the COVID-19 pandemic and recover some normalcy. That itself would prove too big a reach; despite a round of vaccines, the world continues to grapple with this disease, hoping to…

Continue Reading 10 Things to Be Thankful for in 2021

10 Things to Be Thankful for in 2021

Following on the annus horribilus of 2020, expectations for 2021 were high (or maybe, low). Surely we would emerge from the COVID-19 pandemic and recover some normalcy. That itself would prove too big a reach; despite a round of vaccines, the world continues to grapple with this disease, hoping to…

Continue Reading 10 Things to Be Thankful for in 2021

Weill Cornell Creates New Center to Study RNA Modifications with $12M from NHGRI

[Source: CROCOTHERY/Getty Images] The National Human Genome Research Institute (NHGRI) announced Tuesday it has funded a Weill Cornell Medicine-based Center of Excellence in Genome Sciences (CEGS) to study how RNA functions to create the patterns of protein expression seen in human tissues and disease. The multi-institution CEGS will be funded…

Continue Reading Weill Cornell Creates New Center to Study RNA Modifications with $12M from NHGRI

ASM588974v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::05/24/2019 21:11:27 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::4.8 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::8,858 CDSs (total)::8,784 Genes (coding)::8,478 CDSs (with protein)::8,478 Genes (RNA)::74 rRNAs::4, 6, 9 (5S, 16S, 23S) complete rRNAs::4, 1 (5S,…

Continue Reading ASM588974v1 – Genome – Assembly

ASM194254v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::10/13/2016 11:55:59 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline Annotation Method::Best-placed reference protein set; GeneMarkS+ Annotation Software revision::3.3 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::4,882 CDS (total)::4,828 Genes (coding)::4,767 CDS (coding)::4,767 Genes (RNA)::54 rRNAs::1, 1, 1 (5S, 16S, 23S) complete rRNAs::1, 1, 1 (5S, 16S,…

Continue Reading ASM194254v1 – Genome – Assembly

ASM194254v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI Annotation Date::10/13/2016 11:55:59 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline Annotation Method::Best-placed reference protein set; GeneMarkS+ Annotation Software revision::3.3 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::4,882 CDS (total)::4,828 Genes (coding)::4,767 CDS (coding)::4,767 Genes (RNA)::54 rRNAs::1, 1, 1 (5S, 16S, 23S) complete rRNAs::1, 1, 1 (5S, 16S,…

Continue Reading ASM194254v1 – Genome – Assembly

Snpeff annotation question

When I annotated a human genome using reference genome with snpeff, at each genomic position, there are more than one annotation results in the same gene and also other genes appearing and they are separated by “,”. Here is an example below at a genomic position of 204,688,055 on chromosome…

Continue Reading Snpeff annotation question

Diagnostic markers of AIDS combined with TM infection

Introduction The prevalence of Human immunodeficiency virus/Acquired Immune Deficiency Syndrome (HIV/AIDS) is still a public health problem that threatens the health of all human beings. According to the latest report of the World Health Organization, in the end of 2019, there were 38 million patients with human immunodeficiency virus/acquired immunodeficiency…

Continue Reading Diagnostic markers of AIDS combined with TM infection

ASM1066924v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI RefSeq Annotation Date::02/18/2021 05:39:10 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::5.1 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::2,292 CDSs (total)::2,220 Genes (coding)::2,142 CDSs (with protein)::2,142 Genes (RNA)::72 rRNAs::5, 4, 4 (5S, 16S, 23S) complete rRNAs::5, 4,…

Continue Reading ASM1066924v1 – Genome – Assembly

ecDNA hubs drive cooperative intermolecular oncogene expression

1. Wu, S. et al. Circular ecDNA promotes accessible chromatin and high oncogene expression. Nature 575, 699–703 (2019). 2. Gorkin, D. U., Leung, D. & Ren, B. The 3D genome in transcriptional regulation and pluripotency. Cell Stem Cell 14, 762–775 (2014). CAS  PubMed  PubMed Central  Google Scholar  3. Zheng, H….

Continue Reading ecDNA hubs drive cooperative intermolecular oncogene expression

Index of /~psgendb/birchhomedir/GenBank/workspace/reads.uncorr.spades1/K127/configs

Name Last modified Size Description Parent Directory   –   careful_mda_mode.info 2021-06-16 07:02 564   careful_mode.info 2021-06-16 07:02 633   config.info 2021-06-16 07:02 4.2K   construction.info 2021-06-16 07:02 645   detail_info_printer…> 2021-06-16 07:02 1.0K   distance_estimation…> 2021-06-16 07:02 1.4K   large_genome_mode.info 2021-06-16 07:02 126   mda_mode.info 2021-06-16 07:02 1.9K  …

Continue Reading Index of /~psgendb/birchhomedir/GenBank/workspace/reads.uncorr.spades1/K127/configs

R: Predicting G quadruplexes

R: Predicting G quadruplexes gquad {gquad} R Documentation Predicting G quadruplexes Description This function predicts G quadruplexes in ‘x’ (nucleotide sequence(s)). Nucleotide sequence can be provided in raw or fasta format or as GenBank accession number(s). Internet is needed to connect to GenBank database, if accession number(s) is given as…

Continue Reading R: Predicting G quadruplexes

please use ‘assay(x, withDimnames=FALSE))

I’ve got the representation matrix of ribo-seq and RNA-seq, then i use xtail to caculate translation efficiency, my code: ribo <- read.table(‘Ribo-seq_count.txt’,header=T,quote=””,check.names=F, sep=’t’,row.names=1) mrna<- read.table(‘RNA-seq_count.txt’,header=T,quote=””,check.names=F, sep=’t’,row.names=1) condition <- c(“control”,”control”,”treat”,”treat”) results <- xtail(mrna,ribo,condition,minMeanCount=1,bins=10000) then ,its error: Error in assays<-(*tmp*, value = new(“SimpleList”, listData = list( : please use ‘assay(x, withDimnames=FALSE)) <-…

Continue Reading please use ‘assay(x, withDimnames=FALSE))

The genome of the diatom Chaetoceros tenuissimus carries an ancient integrated fragment of an extant virus

1. Field, C. B., Behrenfeld, M. J., Randerson, J. T. & Falkowski, P. Primary production of the biosphere: Integrating terrestrial and oceanic components. Science 281, 237–240 (1998). ADS  CAS  PubMed  Google Scholar  2. Nelson, D. M., Tréguer, P., Brzezinski, M. A., Leynaert, A. & Quéguiner, B. Production and dissolution of…

Continue Reading The genome of the diatom Chaetoceros tenuissimus carries an ancient integrated fragment of an extant virus

The genome of the diatom Chaetoceros tenuissimus carries an ancient integrated fragment of an extant virus

1. Field, C. B., Behrenfeld, M. J., Randerson, J. T. & Falkowski, P. Primary production of the biosphere: Integrating terrestrial and oceanic components. Science 281, 237–240 (1998). ADS  CAS  PubMed  Google Scholar  2. Nelson, D. M., Tréguer, P., Brzezinski, M. A., Leynaert, A. & Quéguiner, B. Production and dissolution of…

Continue Reading The genome of the diatom Chaetoceros tenuissimus carries an ancient integrated fragment of an extant virus

bubble plot of GO terms

bubble plot of GO terms 1 I am working on the differential analysis of RNA seq data. I have done my analysis but now wants to visualize my data in the form of plots. By looking at the publications I am getting to understand that how differential analysis data can…

Continue Reading bubble plot of GO terms

Extract ENSEMBL IDs from processed Seurat object instead of gene symbols

Extract ENSEMBL IDs from processed Seurat object instead of gene symbols 2 Hi Biostars, I have some prefiltered scRNAseq count data and want to extract counts for cells belonging to a specific cluster. The following code retrieves the counts with gene symbols by default: cluster01 <- subset(data_integrated,idents = c(“Cluster 1”))…

Continue Reading Extract ENSEMBL IDs from processed Seurat object instead of gene symbols

ggplot

Forum:ggplot 0 I am working on the differential analysis of RNA seq data. I have done my analysis but now wants to visualize my data in the form of plots. By looking at the publications I am getting to understand that how differential analysis data can use to generate the…

Continue Reading ggplot

simplSEQ Demonstrates Value of New DNA and RNA Isolation Technology

simplSEQ, Inc., a spinout of Murietta Genomics focused on technology for isolating and analyzing circulating nucleic acid to better understand health and disease, presented a poster, “A Novel cfDNA Isolation Procedure: An Enzymatic Modification Method Results in Higher Yields, Simplied Procedure, and Minimized Size Bias,”at the 2021 Association for Molecular Pathology (AMP) annual meeting…

Continue Reading simplSEQ Demonstrates Value of New DNA and RNA Isolation Technology

Environmental DNA sequencing will allow scientists to discover Amazon piscine range with out catching fish

A view of the river the place environmental DNA was collected for comparability with captured specimens. The researchers intention to deposit in public databases sequences of genetic materials representing all orders and households and most genera of Amazonian fish. Credit: David de Santana A scientific expedition within the Javari River…

Continue Reading Environmental DNA sequencing will allow scientists to discover Amazon piscine range with out catching fish

National Human Genome Research Institute fund

image: Dr. Samie Jaffrey view more  Credit: John Abbott The National Human Genome Research Institute has funded a multi-institutional Center of Excellence in Genome Sciences (CEGS), based at Weill Cornell Medicine, to develop new tools to study the major product of the human genome, called ribonucleic acid (RNA), and determine how RNA…

Continue Reading National Human Genome Research Institute fund

Herpes Simplex Virus Type 1 Infection Disturbs the Mitochondrial Network, Leading to Type I Interferon Production through the RNA Polymerase III/RIG-I Pathway

Viruses have evolved a plethora of mechanisms to impair host innate immune responses. Herpes simplex virus type 1 (HSV-1), a double-stranded linear DNA virus, impairs the mitochondrial network and dynamics predominantly through the UL12.5 gene. We demonstrated that HSV-1 infection induced a remodeling of mitochondrial shape, resulting in a fragmentation…

Continue Reading Herpes Simplex Virus Type 1 Infection Disturbs the Mitochondrial Network, Leading to Type I Interferon Production through the RNA Polymerase III/RIG-I Pathway

An RNAseq Analysis of Protective/Repair Pathways.CSV

Mesenchymal stromal cells (MSCs) are an adult derived stem cell-like population that has been shown to mediate repair in a wide range of degenerative disorders. The protective effects of MSCs are mainly mediated by the release of growth factors and cytokines thereby modulating the diseased environment and the immune system….

Continue Reading An RNAseq Analysis of Protective/Repair Pathways.CSV

ajwang3/WangHydrogel-RNASeq: RNA-Sequencing Pipeline for Analysis of In Vitro Liver Inflammatory Stimuli

GitHub – ajwang3/WangHydrogel-RNASeq: RNA-Sequencing Pipeline for Analysis of In Vitro Liver Inflammatory Stimuli You can’t perform that action at this time. You signed in with another tab or window. Reload to refresh your session. You signed out in another tab or window. Reload to refresh your session. Read more here:…

Continue Reading ajwang3/WangHydrogel-RNASeq: RNA-Sequencing Pipeline for Analysis of In Vitro Liver Inflammatory Stimuli

ajwang3/WangHydrogel-RNASeq: RNA-Sequencing Pipeline for Analysis of In Vitro Liver Inflammatory Stimuli

GitHub – ajwang3/WangHydrogel-RNASeq: RNA-Sequencing Pipeline for Analysis of In Vitro Liver Inflammatory Stimuli You can’t perform that action at this time. You signed in with another tab or window. Reload to refresh your session. You signed out in another tab or window. Reload to refresh your session. Read more here:…

Continue Reading ajwang3/WangHydrogel-RNASeq: RNA-Sequencing Pipeline for Analysis of In Vitro Liver Inflammatory Stimuli

Environmental DNA sequencing allows scientists to explore Amazon’s fish diversity without catching fish.

View of the river where environmental DNA was collected for comparison with captured specimens. Researchers aim to register genetic sequences in public databases that represent all orders and families, as well as most genera of Amazon fish. Credit: David de Santana Scientific expeditions in the Javary River basin on the…

Continue Reading Environmental DNA sequencing allows scientists to explore Amazon’s fish diversity without catching fish.

Maturation of 23S rRNA includes removal of helix H1 in many bacteria

In most bacteria, the three ribosomal RNAs (rRNAs) are encoded together in each of several near-identical operons. As soon as the nascent precursor rRNA emerges from RNA polymerase, ribosome assembly begins. This process entails ribosomal protein binding, rRNA folding, rRNA modification, and rRNA processing. In the model organisms Escherichia coli…

Continue Reading Maturation of 23S rRNA includes removal of helix H1 in many bacteria

Lessons Not Learned from an Evangelical Debate

Photo credit: pasja1000, via Pixabay. Editor’s note: In a multipart series, Casey Luskin has been reviewing a new book by philosopher William Lane Craig. Below is the final part. Look here for the full review. In the previous installment of my review of William Lane Craig’s In Quest of the Historical Adam we saw that…

Continue Reading Lessons Not Learned from an Evangelical Debate

CRA Job Ads – Postdoc/Senior scientist position in Bioinformatics/Data Science

Two-year (or more) postdoctoral/senior scientist positions (1-2 positions) is available in the Garg lab at the University of Copenhagen. Our research focus is to develop new computational methods for solving fundamental genomic problems. We are interested in: 1) algorithms and data structure (including string processing/graph) and software development, 2) Deep…

Continue Reading CRA Job Ads – Postdoc/Senior scientist position in Bioinformatics/Data Science

ASM1312795v1 – Genome – Assembly

##Genome-Annotation-Data-START## Annotation Provider::NCBI RefSeq Annotation Date::02/24/2021 04:36:52 Annotation Pipeline::NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method::Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision::5.1 Features Annotated::Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total)::4,765 CDSs (total)::4,714 Genes (coding)::4,652 CDSs (with protein)::4,652 Genes (RNA)::51 rRNAs::3, 4, 4 (5S, 16S, 23S) complete rRNAs::3, 4,…

Continue Reading ASM1312795v1 – Genome – Assembly

BioTechniques Explores the Ethics Surrounding CRISPR Gene Editing

Gene engineering is an umbrella term for several gene-editing systems, including CRISPR (clusters of regularly interspaced short palindromic repeats) techniques. CRISPR describes a region of DNA that holds short, repeated sequences that are sandwiched together with “spacers”. Developments in CRISPR gene editing techniques and technologies have accelerated over the past…

Continue Reading BioTechniques Explores the Ethics Surrounding CRISPR Gene Editing

Environmental DNA sequencing will enable scientists to explore Amazon piscine diversity without catching fish

A view of the river where environmental DNA was collected for comparison with captured specimens. The researchers aim to deposit in public databases sequences of genetic material representing all orders and families and most genera of Amazonian fish. Credit: David de Santana A scientific expedition in the Javari River basin…

Continue Reading Environmental DNA sequencing will enable scientists to explore Amazon piscine diversity without catching fish

DNA sequencing: an overview of solid-state and biological nanopore-based methods

Adams J, Jeppesen P, Sanger F, Barrell B (1969) Nucleotide sequence from the coat protein cistron of R17 bacteriophage RNA. Nature 223:1009–1014. doi.org/10.1038/2231009a0 CAS  Article  PubMed  Google Scholar  Akahori R, Yanagi I, Goto Y, Harada K, Yokoi T, Takeda K-I (2017) Discrimination of three types of homopolymers in single-stranded DNA…

Continue Reading DNA sequencing: an overview of solid-state and biological nanopore-based methods

Testing for the ALK Rearrangements

Karen Reckamp, MD: Dr Patel, can you talk about testing for ALK rearrangements in the clinic? Jyoti Patel, MD: Yes, thank you, and it’s so clinically relevant. The evolution of how we test our patients has rapidly changed in recent years. Certainly, there was a time in which we felt…

Continue Reading Testing for the ALK Rearrangements

Finding differential subpathways of metabolic networks using RNA-seq data

Finding differential subpathways of metabolic networks using RNA-seq data 0 I would like to find a good approach or R/Python package that would help me to find differential subpathways of selected KEGG metabolic pathways. As input, I have expression data of N samples or differential expression data for G group…

Continue Reading Finding differential subpathways of metabolic networks using RNA-seq data

WATCH: Virtual reality tool to be used in fight against disease

Advanced techniques in DNA and RNA sequencing have opened up the possibility of studying individual cells in tissue in a more comprehensive way than was previously possible. The big challenge with these sequencing techniques is that they lead to large amounts of data. “When you want to distinguish cancer cells…

Continue Reading WATCH: Virtual reality tool to be used in fight against disease

STAR alignment barely changes when limiting the maximum number of mismatches

STAR alignment barely changes when limiting the maximum number of mismatches 0 Hello everyone. I’m working with STAR aligner to map microRNA seq samples into the whole mouse genome. While taking a look at the parameters, I noticed the parameter —outFilterMismatchNmax had as default mismatch number 10 (according to the…

Continue Reading STAR alignment barely changes when limiting the maximum number of mismatches

AstraZeneca opens new advanced therapeutics R&D facility in Cambridge

The pharma giant said the new £1bn (US$1.3bn) research and development center will include advanced robotics, high-throughput screening and AI-driven technology. A spokesperson for AstraZeneca told BioPharma-Reporter that the facility aims to pioneer a faster and more agile approach to developing medicines, in order to fully deliver patient-centered precision medicine…

Continue Reading AstraZeneca opens new advanced therapeutics R&D facility in Cambridge

How can I produce gene level quantification using Salmon pseudo-aligner?

How can I produce gene level quantification using Salmon pseudo-aligner? 3 Hi ! I am using Salmon in order to permform pseudo-alignment on paired end rna-seq data. I want a gene quantification but i obtain files cith transcripts quantification : command line used : salmon quant -i Transcriptome_GH38_release_92/Homo_sapiens.GRCh38.92.cdna.ncrna.fa_quasi_index/ -l A…

Continue Reading How can I produce gene level quantification using Salmon pseudo-aligner?

The Biostar Herald for Tuesday, November 23, 2021

The Biostar Herald publishes user submitted links of bioinformatics relevance. It aims to provide a summary of interesting and relevant information you may have missed. You too can submit links here. This edition of the Herald was brought to you by contribution from Mensur Dlakic, Istvan Albert, and was edited…

Continue Reading The Biostar Herald for Tuesday, November 23, 2021

question about debatch in RNA-seq analysis

question about debatch in RNA-seq analysis 0 Hi, I have a question about the debatch in RNA-seq analysis. The situation is like this: We have RNA-seq of EPSC (one type of ESCs) and EPSC-derived TSC. And other data are public, including Naive ESC and Naive-derived TSC, Primed ESC and Primed-derived…

Continue Reading question about debatch in RNA-seq analysis

Bioinformatics analysis pinpoints the pathways involved in intestinal SARS/CoV-2 infection

Severe acute respiratory syndrome coronavirus type 2 (SARS-CoV-2) is a positive-strand RNA virus, which appears spherical under a transmission electron microscope. Many studies have shown that SARS-CoV-2 infects host cells via the interaction between the viral spike protein and the host receptor, angiotensin-converting enzyme II (ACE2). SARS-CoV-2 can spread through…

Continue Reading Bioinformatics analysis pinpoints the pathways involved in intestinal SARS/CoV-2 infection

Bioconductor – dStruct

DOI: 10.18129/B9.bioc.dStruct     Identifying differentially reactive regions from RNA structurome profiling data Bioconductor version: Release (3.14) dStruct identifies differentially reactive regions from RNA structurome profiling data. dStruct is compatible with a broad range of structurome profiling technologies, e.g., SHAPE-MaP, DMS-MaPseq, Structure-Seq, SHAPE-Seq, etc. See Choudhary et al, Genome Biology,…

Continue Reading Bioconductor – dStruct

Variant #0000800672 (NC_000002.11:g.47600684A>C, EPCAM(NM_002354.2):c.159A>C) – Global Variome shared LOVD

Variant #0000800672 (NC_000002.11:g.47600684A>C, EPCAM(NM_002354.2):c.159A>C) Chromosome 2 Allele Unknown Affects function (as reported) Does not affect function Affects function (by curator) Not classified Classification method – Clinical classification benign DNA change (genomic) (Relative to hg19 / GRCh37) g.47600684A>C DNA change (hg38) – Published as EPCAM(NM_002354.2):c.159A>C (p.A53=) ISCN – DB-ID EPCAM_000318 Variant remarks VKGL data sharing initiative Nederland Reference – ClinVar ID – dbSNP ID – Origin CLASSIFICATION record Segregation – Frequency –…

Continue Reading Variant #0000800672 (NC_000002.11:g.47600684A>C, EPCAM(NM_002354.2):c.159A>C) – Global Variome shared LOVD

What does rRNA do? (Multiple Choice Quiz)

Home What does rRNA do? (Multiple Choice Quiz) What does rRNA do? (Multiple Choice Quiz) This is a List of Available Answers Options : carry info from genes to ribosomes carry amino acids to ribosomes help with RNA splicing make up ribosomes The best answer is D. carry info from…

Continue Reading What does rRNA do? (Multiple Choice Quiz)

Building the Data Foundation for Faster Time to Science in Healthcare

Contributed Commentary by Bill Lynch, Pure Storage November 23, 2021 | The COVID-19 pandemic pushed advancements in medical science to speeds once considered impossible. Consider this: it took over 20 years to develop a vaccine for polio and now, just 60 years later, the COVID-19 vaccine was developed and distributed…

Continue Reading Building the Data Foundation for Faster Time to Science in Healthcare

QIAGEN hiring Bioinformatics Scientist in United States

Overview At the heart of QIAGEN’s business is a vision to make improvements in life possible. We are on an exciting mission to make a real difference in science and healthcare. We are still the entrepreneurial company we started out as and have today achieved a size where we can…

Continue Reading QIAGEN hiring Bioinformatics Scientist in United States

Bioinformatics Postdoctoral Research Associate, Bioinformatics Group

Job Description Benaroya Research Institute at Virginia Mason (BRI) is an internationally recognized non-profit medical research institute affiliated with the Virginia Mason Health System. BRI works to advance the science that will predict, prevent, reverse and cure diseases of the immune system, to achieve its vision of a healthy immune…

Continue Reading Bioinformatics Postdoctoral Research Associate, Bioinformatics Group

WGCNA Analysis Identifies Polycystic Ovary Syndrome-Associated Circula

Introduction Polycystic ovary syndrome (PCOS) is a common endocrine metabolic disorder in women of childbearing age.1 PCOS patients are typically characterized by androgen excess, polycystic ovaries and anovulation, and are often accompanied by insulin resistance and obesity.2 Consequently, patients with this syndrome not only suffer from infertility,3 but also have…

Continue Reading WGCNA Analysis Identifies Polycystic Ovary Syndrome-Associated Circula

ToolGen Files Motion to Exclude Evidence, CVC Opposes, and ToolGen Replies in Interference No. 106,127 | McDonnell Boehnen Hulbert & Berghoff LLP

In its turn, on September 17th, Senior Party ToolGen Inc. filed its Motion to Exclude certain evidence presented by Junior Party the University of California/Berkeley, the University of Vienna, and Emmanuelle Charpentier (collectively, “CVC”) in Interference No. 106,127.  CVC filed its Opposition to ToolGen’s motion on October 8th, and ToolGen filed…

Continue Reading ToolGen Files Motion to Exclude Evidence, CVC Opposes, and ToolGen Replies in Interference No. 106,127 | McDonnell Boehnen Hulbert & Berghoff LLP

Analyzing DEG from different dataset in my study design

Analyzing DEG from different dataset in my study design 0 Hi I have a situation here which make me confused and not sure if i have every thing right. I compared 5 different datasets in one study with each other separately. for example data1 vs data2, data1 vs data3, data1…

Continue Reading Analyzing DEG from different dataset in my study design

Senior Bioinformatics Scientist in Cambridge, Cambridgeshire | The Tec Recruitment Group Limited

Senior Bioinformatics Scientist – Cambridge Remote/hybrid working option Role overview: You will be part of an industry leading Genomics company, who are working in the development and accessibility of sequencing products to push the boundaries of drug discovery and therapy development. You will be part of a global team of…

Continue Reading Senior Bioinformatics Scientist in Cambridge, Cambridgeshire | The Tec Recruitment Group Limited