Tag: snap

r – Move positioning of x axis labels in ggplot without hjust or vjust

Using some sample data from BLS below, I’m trying to make a faceted plot of spending categories by income bracket. Because some of the label names are long, I have them rotated 90 degrees. I have been using hjust and vjust to move around the labels a bit, but I…

Continue Reading r – Move positioning of x axis labels in ggplot without hjust or vjust

Unusual mode of dimerization of retinitis pigmentosa-associated F220C rhodopsin.

Unusual mode of dimerization of retinitis pigmentosa-associated F220C rhodopsin. Publication ,  Journal Article Khelashvili, G; Pillai, AN; Lee, J; Pandey, K; Payne, AM; Siegel, Z; Cuendet, MA; Lewis, TR; Arshavsky, VY; Broichhagen, J; Levitz, J; Menon, AK Published in: Sci Rep Mutations in the G protein-coupled receptor (GPCR) rhodopsin are a…

Continue Reading Unusual mode of dimerization of retinitis pigmentosa-associated F220C rhodopsin.

Google Announced Gemini, And Imagen 2 API For Developers

Google has recently announced the Gemini AI, along with Imagen 2 and Duet AU for developers. These can be used to develop tools and integrate them into their products and services. All of these are available with Gemini, Imagen 2, and Duet AI on Vertex AI (Google Cloud API solution…

Continue Reading Google Announced Gemini, And Imagen 2 API For Developers

Analysis of sepsis combined with pulmonary infection by mNGS

Introduction Sepsis is one of the major diseases that poses a serious threat to human health, and its incidence and in-hospital mortality rates remain high despite the continuous updating of sepsis guidelines.1 Its main clinical manifestations are elevated body temperature, chills, and rapid heart rate, and it is most common…

Continue Reading Analysis of sepsis combined with pulmonary infection by mNGS

Stocks Gain; Oil Rises as Conflict Disrupts Red Sea Shipping

Communications Sector Gets a Boost from FAANG 37 minutes ago The communications sector was the best-performing corner of the market Monday, buoyed by big tech firms Meta (META), Netflix (NFLX), and Alphabet (GOOGL). Shares of each were about 3% high Monday afternoon, possibly buoyed by conviction the digital advertising market is…

Continue Reading Stocks Gain; Oil Rises as Conflict Disrupts Red Sea Shipping

hypothetical protein LOTGIDRAFT_99224 partial, maker-scaffold1322_size48131-snap-gene-0.13 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of hypothetical protein LOTGIDRAFT_99224 partial vs. L. salmonis genes Match: EMLSAG00000006769 (supercontig:LSalAtl2s:LSalAtl2s379:476161:478870:-1 gene:EMLSAG00000006769 transcript:EMLSAT00000006769 description:”maker-LSalAtl2s379-augustus-gene-4.10″) HSP 1 Score: 59.6918 bits (143), Expect = 4.225e-12Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 0 Query: 22 AANARERTRMRVLSKAFGRLKLTLPWVPPDTKLSKLDTLRLATSYISHLQRLLSDEE 78 +N +ER R + ++…

Continue Reading hypothetical protein LOTGIDRAFT_99224 partial, maker-scaffold1322_size48131-snap-gene-0.13 (gene) Tigriopus kingsejongensis

Google’s Latest AI Image Generator Does Text and Logos Too

Image generated with Imagen on Vertex AI from the prompt: portrait of a french bulldog at the beach, 85mm f/2. Google has “launched” a second version of its AI image generator model but only to Google Cloud customers who use Vertex AI. Imagen 2 is the search giant’s most advanced…

Continue Reading Google’s Latest AI Image Generator Does Text and Logos Too

Google’s Imagen AI Technology Can Now Create Logos, Overlay Text Onto Objects | Dieline

Technology giant Google has announced significant upgrades to its Generative Artificial Intelligence (GAI) technology, Imagen 2, available to “allow listed” Vertex AI customers. Significant upgrades to Imagen 2 include creating logos, multi-language support, and overlaying text and logos on generated images, whether it’s a business card or a beer can. Most impressively,…

Continue Reading Google’s Imagen AI Technology Can Now Create Logos, Overlay Text Onto Objects | Dieline

Reading a word problem stored in a image? – vision

ThePie December 14, 2023, 8:36pm 1 I wanted to see what models would be best suited for taking in a image and having the model perform a image to text (OCR of some kind) and then outputting the contents of the image in a “question” “answers” format. The set of…

Continue Reading Reading a word problem stored in a image? – vision

Google Unveils Imagen 2 for AI Image Creation

Google has unveiled an enhanced iteration of its image-generation technology known as Imagen 2. This upgraded tool, integrated into Google Cloud’s Vertex AI for exclusive customers, excels in transforming text into visually compelling images. Imagen 2 boasts remarkable features that empower users to generate superior images through textual input….

Continue Reading Google Unveils Imagen 2 for AI Image Creation

Google Aims To Outshine Midjourney And DALL-E With Imagen 2

In a recent announcement, Google has launched Imagen 2, an enhanced version of its text-to-image technology, offering remarkable features to transform words into stunning visuals. Exclusively available to special customers using Vertex AI on Google Cloud, Imagen 2 is powered by intelligent technology from Google DeepMind, significantly improving image quality….

Continue Reading Google Aims To Outshine Midjourney And DALL-E With Imagen 2

Google Cloud announces Imagen 2 text-to-image generator

Google Cloud has introduced Imagen 2, the latest upgrade to its text-to-image capabilities. Available for Vertex AI customers on the allowlist, Imagen 2 enables users to craft and deploy photorealistic images using intuitive tooling and fully-managed infrastructure.  Developed with Google DeepMind technology, Imagen 2 offers improved image quality and a…

Continue Reading Google Cloud announces Imagen 2 text-to-image generator

Google Cloud launches Imagen 2 on Vertex AI to Revolutionize Image Generation

Google Cloud has unveiled Imagen 2, its most advanced text-to-image technology. It is now generally available exclusively for Vertex AI customers on the allowlist. Imagen 2 comes with significant upgrades to image generation capabilities offering customizable deployment, intuitive tooling, managed infrastructure, and built-in privacy and safety features. What are the…

Continue Reading Google Cloud launches Imagen 2 on Vertex AI to Revolutionize Image Generation

Google takes the wraps off its next-gen DALL-E 3 competitor

Summary Google has developed Imagen 2, a text-to-image AI technology, to rival OpenAI’s DALL-E 3. Imagen 2 offers higher quality images, text rendering in multiple languages, logo generation, and more. Google continues to keep pace with OpenAI’s developments and is actively exploring the potential of AI. Even if you aren’t…

Continue Reading Google takes the wraps off its next-gen DALL-E 3 competitor

Imagen 2 on Vertex AI is now generally available

Captions and question-answer: Imagen 2’s enhanced image understanding capabilities enable customers to create descriptive, long-form captions and get detailed answers to questions about elements within the image. Multi-language prompts: Beyond English, Imagen 2 is launching with support for six additional languages (Chinese, Hindi, Japanese, Korean, Portuguese, Spanish) in preview, with…

Continue Reading Imagen 2 on Vertex AI is now generally available

ggplot2 – Error knitting from R Markdown ggplot – unexpected special character that doesn’t exist

I’m getting an error when I try to knit my .Rmd file. The code itself runs fine inside the file; the error only occurs when I try to knit. Quitting from lines 103-118 [unnamed-chunk-4] (Lab-14.Rmd) Warning messages: 1: In eng_r(options) : Failed to tidy R code in chunk ‘unnamed-chunk-2’. Reason:…

Continue Reading ggplot2 – Error knitting from R Markdown ggplot – unexpected special character that doesn’t exist

Cell Membrane Chromatography Using HALO-tag Technology

A group of scientists from Xi’an, China have created a new system for analyzing cell membranes based around haloalkane dehalogenase protein tag (HALO)-tag technology. Their research was published in Talanta (1). Cell membrane chromatography (CMC) is effective for studying receptors with multiple transmembrane structures, such as MAS-related G protein-coupled receptor…

Continue Reading Cell Membrane Chromatography Using HALO-tag Technology

Does free enery perturbation can be applied to the system described by deep learning potential model? – LAMMPS Development

Dear Lammps developers.I learned that free energy perturbation has been integrated within the scheme of lammps. Some machine learning potentials, such as deep potentials, eann, mace, etc. I wonder does fep can be applied to systems described by machine learning potentials.Best wishes,Peng diracliup: I wonder does fep can be applied…

Continue Reading Does free enery perturbation can be applied to the system described by deep learning potential model? – LAMMPS Development

Jessica Simpson shows off her trim waist in skintight top and sequin trousers in new snap for her clothing label

By Sarah Sotoodeh For Dailymail.com Published: 19:51 GMT, 6 December 2023 | Updated: 20:09 GMT, 6 December 2023 Jessica Simpson showcased her trim waist in a new snap on her Instagram page for her brand Jessica Simpson Style. The mother of three, 43, wore a white bodysuit paired with sequin…

Continue Reading Jessica Simpson shows off her trim waist in skintight top and sequin trousers in new snap for her clothing label

Strong chemotaxis by marine bacteria towards polysaccharides is enhanced by the abundant organosulfur compound DMSP

ISCA fabrication VeroGray polymer was used to create 3D-printed moulds on an Objet30 3D printer (Stratasys), using previously described protocols32. Each ISCA consisted of 25 wells arranged in a 5 × 5 array. Each 110 µL well possessed a 800-μm-diameter port that connected the inside of the well with the surrounding seawater and…

Continue Reading Strong chemotaxis by marine bacteria towards polysaccharides is enhanced by the abundant organosulfur compound DMSP

Deep Learning With PyTorch (Audiobook) | Santa Clara County Library

With this publication, we finally have a definitive treatise on PyTorch. It covers the basics and abstractions in great detail. From the Foreword by Soumith Chintala, Cocreator of PyTorch Every other day we hear about new ways to put deep learning to good use: improved medical imaging, accurate credit card…

Continue Reading Deep Learning With PyTorch (Audiobook) | Santa Clara County Library

The crucial role of tissue quality in precision oncology

In precision oncology, tissue quality plays a pivotal role in maintaining data integrity. We explore the impact of standardizing tissue collection and processing on data quality, and how this helps enhance patient outcomes as well as our understanding of cancer. Insights from tissue samples play an important role across the…

Continue Reading The crucial role of tissue quality in precision oncology

Problem with GW core electron calculations

Dear CP2K users   I try to calculate core binding energies using GW calculations. I am interested in the Cl2p line of a Cl- ion on the top of Mg*6H2O crystal:  I performed a first-principle MD, and due to the computational/ memory cost of the calculations, I extracted different snapshots…

Continue Reading Problem with GW core electron calculations

Snap Gene viewer information for DNA sequence data 2023-2024 – SnapGene viewer information for DNA

SnapGene viewer information for DNA sequence data Download free version of SnapGene Viewer. Do NOT sign up for ‘free’ trial full version as after 1 month you then need to pay and you do NOT need full version. snapgene/snapgene-viewer/ Pick the version for PC or Mac and one which fits…

Continue Reading Snap Gene viewer information for DNA sequence data 2023-2024 – SnapGene viewer information for DNA

Partners hope to regenerate heart tissue using ncRNA

Ethris and Heqet Therapeutics have revealed plans to collaborate on RNA-based therapeutics for heart attack and heart failure, using non coding RNAs (ncRNAs) in regenerating heart tissue. Under the terms of the agreement, Heqet Therapeutics will lead the development of the programme, while Ethris will provide its proprietary Stabilized NanoParticle…

Continue Reading Partners hope to regenerate heart tissue using ncRNA

gene therapy pioneer to biotech rebuff?

Once thought to be a frontrunner in gene therapy, uniQure’s fame may no longer be coveted, as the biotech looks to reorganize by slashing its workforce, in an attempt to stay afloat. But how did things go awry for the company that was once in its prime in the DNA…

Continue Reading gene therapy pioneer to biotech rebuff?

Ethris, Heqet Partner On RNA-based Heart Disease Therapeutics

Ethris GmbH, a biotechnology company pioneering next-generation RNA therapeutics and vaccines, and Heqet Therapeutics, a biotechnology spin-out company from King’s College London active in the field of regenerative medicine, entered into a collaboration agreement to harness the potential of ncRNA for heart tissue regeneration following acute myocardial infarction (heart attack)…

Continue Reading Ethris, Heqet Partner On RNA-based Heart Disease Therapeutics

Ethris and Heqet Therapeutics Announce Collaboration to

Collaboration will harness the potential of non coding RNAs (ncRNAs) in regenerating heart tissue Ethris will contribute its proprietary SNaP LNP platform for precise ncRNA delivery while Heqet Therapeutics will lead preclinical and clinical development Ethris to receive milestone and royalty payments, highlighting the commitment of both companies to advance…

Continue Reading Ethris and Heqet Therapeutics Announce Collaboration to

RNAseq from P4 murine whole kidneys with Polycystic Kidney Disease

Snap frozen Postnatal day4 murine kidney tissues were crushed using micropestles in RLT Buffer and RNA was extracted from these tissues using QiaShredders followed by Qiagen RNAeasy Mini Kits according to manufacturer’s protocol. RNA concentration and integrity were determined by Aligent bioanalyzer. cDNA library preparation was carried out using NEB…

Continue Reading RNAseq from P4 murine whole kidneys with Polycystic Kidney Disease

Chromosome-level genomes of three key Allium crops and their trait evolution

Chase, M. W. et al. An update of the Angiosperm Phylogeny Group classification for the orders and families of flowering plants: APG IV. Bot. J. Linn. Soc. 181, 1–20 (2016). Article  Google Scholar  Jones, M. G. et al. Biosynthesis of the flavour precursors of onion and garlic. J. Exp. Bot….

Continue Reading Chromosome-level genomes of three key Allium crops and their trait evolution

Index of /~psgendb/birchhomedir/admin/launchers/biolegato.app/Contents/Resources/pkg/transrate/bin

Name Last modified Size Description Parent Directory   –   bam-read 2016-06-06 08:37 5.4M   libgcc_s.so.1 2019-03-08 21:07 89K   libgomp.so.1 2019-03-08 21:07 83K   liblzma.so.0 2019-03-08 21:07 132K   libm.so.6 2019-03-08 21:07 582K   libtbb.so 2019-03-08 21:07 20   libtbb.so.2 2019-03-08 21:07 4.5M   libtbbmalloc.so 2019-03-08 21:07 26  …

Continue Reading Index of /~psgendb/birchhomedir/admin/launchers/biolegato.app/Contents/Resources/pkg/transrate/bin

papain family cysteine protease containing protein, maker-scaffold1702_size30647-snap-gene-0.14 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of papain family cysteine protease containing protein vs. L. salmonis genes Match: EMLSAG00000006045 (supercontig:LSalAtl2s:LSalAtl2s327:400616:404607:-1 gene:EMLSAG00000006045 transcript:EMLSAT00000006045 description:”augustus_masked-LSalAtl2s327-processed-gene-4.0″) HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0Identity = 283/525 (53.90%), Postives = 368/525 (70.10%), Query Frame = 0 Query: 49 GHVARPLGKSPPNFVRDPPPRTTPPAQWLWNNVNETNFLTVSRNQHLPTYCGSCWAHAATSSLSDRIKIARQGAWPDINLAPQVLISCGPGDGCHGGEAGDANAYMHAQGITDETCSIYRARGQDNGLPCSKLEICSTCE—SKCYQPQHFFTYRVDEFHDVEGESNGEQEANMMAEIHHRGPISCGIAVTQALV-NYTGGLFHDKTGAQEIDHDISVVGYGVDEGTQEKYWLIRNSWGTYWGEQGFFRLIRGVNNLGIESGTCSWATPADTWSDAARE—RAAILSNEITLQKP——LWKQLWTVVADFVDNTRDTDLFRRLKLMQKGCKKLSSPRVPVVNIRPRPQDYVSTADLPEALDWRSVNGTNFLSWSVNQHLPVYCGSCWAQAGLSSLADRFTIADRKRFANLALSVQYILNCQAGGSCHGGDAFPLYAFIQKQGVPDVTCQPYEALDEGPLTDCSKPSKLVCKDCTWPPPEPGQEGNCWAKEKFHRYYVDEYNGVEGADNMKKEILERGPVT 560 GH+ R G+…

Continue Reading papain family cysteine protease containing protein, maker-scaffold1702_size30647-snap-gene-0.14 (gene) Tigriopus kingsejongensis

coatomer subunit alpha, maker-scaffold52_size450388-snap-gene-3.16 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of coatomer subunit alpha vs. L. salmonis genes Match: EMLSAG00000004199 (supercontig:LSalAtl2s:LSalAtl2s221:488387:561813:1 gene:EMLSAG00000004199 transcript:EMLSAT00000004199 description:”maker-LSalAtl2s221-augustus-gene-5.19″) HSP 1 Score: 208.379 bits (529), Expect = 8.743e-63Identity = 95/135 (70.37%), Postives = 99/135 (73.33%), Query Frame = 0 Query: 1 MLTKFETKSPRVKGLAFHPQRPWILASLHNGVIQLWDYRMCTLLEKFDEHEGPVRGIGFHAQQPLFVSGGDDYKIKVWNYKLKRCLFHLLGHLDYIRTTVFHAPVPHARRISPAGPAESSTYLAKIHGLWGWKAR 135 MLTKFETKSPRVKGLAFHP+RPWILASLHNGVIQLWDYRMC LLEKFDEHEGP GI H QPLFVSGGDDYKIKVWNYKLKRCLF LLGHLDYIR…

Continue Reading coatomer subunit alpha, maker-scaffold52_size450388-snap-gene-3.16 (gene) Tigriopus kingsejongensis

Annotating genome based on Sequence

Annotating genome based on Sequence 0 Hi all, I was wondering if anyone knows of an R package to annotate genomes based on the sequence of features. For example, I would like to use a list of features with their corresponding sequences that I have made as a database and…

Continue Reading Annotating genome based on Sequence

How to Install DataSpell on Linux: A Comprehensive Guide

With the boom of AI and data science, there’s a rise in the need for data scientists and machine learning engineers as well. Those engineers and developers need tools like an IDE to write their code and train models. A specialized IDE can enhance their workflow and improve their efficiency….

Continue Reading How to Install DataSpell on Linux: A Comprehensive Guide

Reduction of retinal ganglion cell death in mouse models of familial dysautonomia using AAV-mediated gene therapy and splicing modulators

Animals All mice were housed in the AALAC-accredited Animal Resource Center at Montana State University. All animal use protocols were approved by the Montana State University Institutional Animal Care and Use Committee (IACUC) (protocol No. 2020-15-IA; Bozeman, MT). The study fulfilled the ARRIVE guidelines, and all experiments complied with relevant…

Continue Reading Reduction of retinal ganglion cell death in mouse models of familial dysautonomia using AAV-mediated gene therapy and splicing modulators

AI Briefing: More companies are advertising AI as spending picks up

Companies investing in AI are increasingly investing more to market it. At least $40 million has been spent this year on advertising AI products across print, digital, TV and events, according the ad-tracking firm MediaRadar. And in recent months, momentum is picking up. Tech giants and startups racing to stand…

Continue Reading AI Briefing: More companies are advertising AI as spending picks up

Is retroelement-based gene editing a safer alternative to CRISPR-Cas approaches?

Reviewed by Lily Ramsey, LLMOct 26 2023 Precision genome editing technologies have transformed modern biology. Capabilities for programable DNA targeting have improved rapidly, largely due to the development of bacterial RNA-guided CRISPR-Cas systems, which allow precise cleavage of target DNA sequences. However, CRISPR-Cas9 systems generate a DNA double strand break…

Continue Reading Is retroelement-based gene editing a safer alternative to CRISPR-Cas approaches?

NCT/DKFZ MASTER handbook of interpreting whole-genome, transcriptome, and methylome data for precision oncology

Patient characteristics and tissue context The clinical interpretation of molecular alterations starts with evaluating relevant patient characteristics and the tissue context in which a genetic profile occurs. The former relates, in particular, to previous therapies, in addition to disease stage and clinical performance status. For example, prior targeted therapies warrant…

Continue Reading NCT/DKFZ MASTER handbook of interpreting whole-genome, transcriptome, and methylome data for precision oncology

Bioinformatic Analysis of circRNAs in Human ASO

Introduction Arteriosclerosis obliterans (ASO) is a chronic disorder with atherosclerosis involving lower extremity arteries leading to arterial stenosis or occlusion. The incidence continues to increase with age, affecting about 202 million people worldwide to varying degree.1–3 Despite the proposed theories of lipid infiltration, arterial intimal injury, and chronic inflammation, the…

Continue Reading Bioinformatic Analysis of circRNAs in Human ASO

Install python lammps in a non-standard directory – LAMMPS Installation

izosgi October 23, 2023, 1:20pm 1 Dear all, I am trying to install LAMMPS v2Aug2023.update1 in a cluster.I am using EasyBuild to do this, but it does not succeed to install the python lammps/ directoy into non standard: $LAMMPS_DIR/lib64/python/python3.10/site-package I use cmake and enable python, but the system does not…

Continue Reading Install python lammps in a non-standard directory – LAMMPS Installation

What can you expect from Ubuntu 23.10?

• Ubuntu 21.10 focuses on stronger security.• It also includes smoother app discovery processes.• In advance of next year’s bigger update, Ubuntu 23.10 offers a surprising amount of additional refinement. On October 12th, Canonical announced the release of Ubuntu 23.10. It’s not exactly “lines around the Apple store” time, but…

Continue Reading What can you expect from Ubuntu 23.10?

Radiopharmaceuticals market booms with funding surge

Emerging as a new class of drugs, radiopharmaceuticals are all the rage in cancer treatment research, at present. And now, with American biotech Nucleus RadioPharma raising $56 million to streamline its supply chains and make the drugs more accessible, it seems like the radiopharmaceutical market might be onto something big….

Continue Reading Radiopharmaceuticals market booms with funding surge

How the Venus Flytrap Captures Its Prey

An insect lands on the open leaves of a Venus flytrap plant, drawn to an appealing scent. It noses around and accidentally brushes one of the trap’s trigger hairs. An action potential shoots across the leaf blade. The insect keeps moving and bends another trigger hair, propagating a second action…

Continue Reading How the Venus Flytrap Captures Its Prey

EOGT enables residual Notch signaling in mouse intestinal cells lacking POFUT1

Single cell RNAseq bioinformatics Bioinformatic trajectory analysis of scRNAseq data obtained from Epcam+CD45− C57Bl6/J adult intestinal crypt cells and deposited as GSE188339 was performed as described35. Primers and antibodies Primer sequences are given in Supplementary Table 1 and antibodies are given in Supplementary Table 2. Generation of Chinese hamster ovary…

Continue Reading EOGT enables residual Notch signaling in mouse intestinal cells lacking POFUT1

To Freeze Graphene sheet – User discussions

Piyusa October 14, 2023, 9:20am 1 GROMACS version:GROMACS modification: Yes/NoHere post your questionI am doing a simulation with a Graphene sheet with solvent. I want to make the graphene freeze in its initial position but after heating it is moving up. Below I have attached the mdp file and initial…

Continue Reading To Freeze Graphene sheet – User discussions

Using OpenAPI to detect breaking changes in tRPC

Before diving into the technicalities, we need to ensure that everyone is on the same page regarding the setup. We will be using aNext.js app with a tRPC server set up. Although detecting breaking changes might seem redundant for an app that solely consumes its own API, presenting this solution…

Continue Reading Using OpenAPI to detect breaking changes in tRPC

Quickstart your Hugo website with this Hugo tutorial

We recommend the easy one-minute website creation with GitHub before considering following the steps on this page to download and edit your site locally 🧙‍♂️ Did you know that editing or updating a site can be more easily performed online using the GitHub Editor and the open source Wowchemy CMS?…

Continue Reading Quickstart your Hugo website with this Hugo tutorial

Snapchat My AI chatbot may be banned in UK

Snapchat My AI gained a lot of attention when it first rolled out. People have been using the AI chatbot as their friends and are sharing various personal information which is raising major privacy concerns, especially for children. UK watchdog is now assessing the privacy risks of Snapchat’s AI chatbot…

Continue Reading Snapchat My AI chatbot may be banned in UK

The breakthrough in gene editing reveals the potential of Compact Enzyme as an effective treatment

A new CRISPR gene-editing tool, AsCas12f, has been developed and refined to be much more effective and compact than Cas9, which is widely used and could be used in genome-editing applications in humans. The AsCas12f enzyme, which is a CRISPR-based gene-editing tool, has been developed which is reminiscent of the…

Continue Reading The breakthrough in gene editing reveals the potential of Compact Enzyme as an effective treatment

How some plants became carnivorous predators

Toward the end of the 19th century, lurid tales of killer plants began popping up everywhere. Terrible, tentacle-waving trees snatched and swallowed unwary travelers in far-off lands. Mad professors raised monstrous sundews and pitcher plants on raw steak until their ravenous creations turned and ate them too. The young Arthur…

Continue Reading How some plants became carnivorous predators

These Eight Inspiring Women Won the Nobel Prize in Chemistry

The 2023 Chemistry Nobel Prize has been announced today as going to Moungi G. Bawendi, Louis E. Brus and Alexei I. Ekimov “for the discovery and synthesis of quantum dots.” The news came just days after Katalin Karikó became only the 13th woman to win the Nobel Prize in Physiology…

Continue Reading These Eight Inspiring Women Won the Nobel Prize in Chemistry

Here Is A Look At Past Winners

Nobel Prize 2023: The Nobel prizes are announced in early October. Stockholm: Here is a list of Nobel Chemistry Prize winners over the past 10 years: 2022: Carolyn Bertozzi (US), Morten Meldal (Denmark) and Barry Sharpless (US) for the development of click chemistry in which molecular building blocks snap together…

Continue Reading Here Is A Look At Past Winners

Building LAMMPS with GPU single precision support on v100 nodes – LAMMPS Installation

Hello,I would like to build lammps with libgpu support in single precision on V100 nodes. I am using the following cmake command:cmake -DPKG_GPU=on -DPKG_REAXFF=on -DPKG_MANYBODY=on -DPKG_ML-SNAP=on -DPKG_ASPHERE=on -DPKG_RIGID=on -DPKG_REPLICA=on -DPKG_kspace=on -DPKG_MOLECULE=on -DPKG_EXTRA-MOLECULE=on -DBUILD_MPI=on -DCMAKE_INSTALL_PREFIX=…/install_v100_gpu_single -DMPI_CXX_COMPILER=(which mpicxx) \ -DCMAKE_BUILD_TYPE=Release \ -DCMAKE_CXX_STANDARD=14 \ -DCMAKE_CXX_COMPILER=(which mpicxx) -DGPU_API=cuda -DGPU_PREC=single -DGPU_ARCH=sm_70 …/lammps/cmake and I am…

Continue Reading Building LAMMPS with GPU single precision support on v100 nodes – LAMMPS Installation

IJMS | Free Full-Text | CRISPR-Cas9 Direct Fusions for Improved Genome Editing via Enhanced Homologous Recombination

Over the past decade, CRISPR-Cas9 has found widespread application in loss-of-function mutations, but precise genetic engineering for gene correction or gene replacement therapies has lagged behind. In vivo correction using CRISPR-Cas9 to replace genetic mutations by HR is highly challenging, and very few studies have managed to achieve this [31,32]….

Continue Reading IJMS | Free Full-Text | CRISPR-Cas9 Direct Fusions for Improved Genome Editing via Enhanced Homologous Recombination

Train and Deploy Model With Vertex AI

Machine learning models may be created, deployed, and managed on Google Cloud using the Vertex AI service. Vertex AI may be used to supply models with live or batch predictions and train models using a variety of techniques, including AutoML or custom training. This post will demonstrate how to use…

Continue Reading Train and Deploy Model With Vertex AI

The localization of centromere protein A is conserved among tissues

Earnshaw, W. C. & Migeon, B. R. Three related centromere proteins are absent from the inactive centromere of a stable isodicentric chromosome. Chromosoma 92, 290–296 (1985). Article  CAS  PubMed  Google Scholar  Choo, K. H. Centromerization. Trends Cell Biol. 10, 182–188 (2000). Article  CAS  PubMed  Google Scholar  Marshall, O. J., Chueh,…

Continue Reading The localization of centromere protein A is conserved among tissues

Metabolite interactions in the bacterial Calvin cycle and implications for flux regulation

Cultivations and harvest Cupriavidus necator strain DSMZ 428 was grown in Ralstonia Minimal Media (RMM) with 100 mM HEPES pH 7.5 under chemostat conditions in a Photon Systems Instruments Multi-Cultivator MC-1000 OD. Each reactor tube was set up to a volume of 55 mL, OD600 0.05 and 3.5 g/L fructose. Once growth ceased,…

Continue Reading Metabolite interactions in the bacterial Calvin cycle and implications for flux regulation

A new fluorescence-based approach for direct visualization of coat formation during sporulation in Bacillus cereus

TMR-star and MTG bind to the forespore surface and their signal localization reflects the pattern of coat deposition We previously used the self-labelling SNAP-tag to determine the localization of early assembling exosporium proteins during B. cereus sporulation17. Indeed, SNAP-protein fusions can be localized by fluorescence microscopy upon addition of a…

Continue Reading A new fluorescence-based approach for direct visualization of coat formation during sporulation in Bacillus cereus

hypothetical protein LOTGIDRAFT_112989, maker-scaffold299_size217019-snap-gene-1.29 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of hypothetical protein LOTGIDRAFT_112989 vs. L. salmonis genes Match: EMLSAG00000011196 (supercontig:LSalAtl2s:LSalAtl2s761:366436:368626:1 gene:EMLSAG00000011196 transcript:EMLSAT00000011196 description:”maker-LSalAtl2s761-augustus-gene-2.9″) HSP 1 Score: 208.764 bits (530), Expect = 1.424e-65Identity = 100/171 (58.48%), Postives = 126/171 (73.68%), Query Frame = 0 Query: 120 NPIVFFDITIGGDPVGRIVMELYANVVPKTVDNFRALCTGEKGQVGGSGIPLHYKNSSFHRVINRFMLQGGDFTAGDGTGGASIYGEKFADENFLLKHEKPGLLSMANAGPGTNGSQFFLTTVNCPHLDGKHVVFGRAIKGMGIVNEIEVMETT-SDKPNVEVKIADCGQI 289 NP+VFFDI +G +GRIVMEL+A+V PKT +NFR CTGE…

Continue Reading hypothetical protein LOTGIDRAFT_112989, maker-scaffold299_size217019-snap-gene-1.29 (gene) Tigriopus kingsejongensis

blastn Command Not Found

blastn Command Not Found 1 Hi. I’m working in Terminal on a shared server to look at some WGS data. I need to use abricate and blastn. The professor who “owns” the computer wants things downloaded by her and then used by everyone else, so she created an abricate_users group,…

Continue Reading blastn Command Not Found

Dna Sequence iPhone Case by Scott Camazine – Science Source Prints

Warning The image is near the edges of the product but doesn’t cover the entire product.   Some of the background color may appear around the outside edges of the image. Product Details Dna Sequence iPhone case by Scott Camazine.   Protect your iPhone with an impact-resistant, slim-profile, hard-shell case. The image is printed…

Continue Reading Dna Sequence iPhone Case by Scott Camazine – Science Source Prints

A G1528C Hadha knock-in mouse model recapitulates aspects of human clinical phenotypes for long-chain 3-hydroxyacyl-CoA dehydrogenase deficiency

All animal procedures were reviewed and approved by the OHSU IACUC (eIACUC #B11243). All experiments were performed in accordance with AAALAC and ARRIVE guidelines. Age, sex, and N of the mice for each experiment can be found in Supplementary Data 1. Mouse creation Mice were created through Cyagen Biosciences (Santa Clara,…

Continue Reading A G1528C Hadha knock-in mouse model recapitulates aspects of human clinical phenotypes for long-chain 3-hydroxyacyl-CoA dehydrogenase deficiency

10 Best Quotes From Avengers: Endgame

The Marvel Cinematic Universe‘s Infinity Saga came to an exciting and memorable end in 2019’s Avengers: Endgame, the final movie of Phase 3. In that movie, Thanos had already won, but the surviving Avengers were ready to fight back and use the Infinity Stones to turn a devastating defeat into…

Continue Reading 10 Best Quotes From Avengers: Endgame

Microorganisms | Free Full-Text | Genome-Wide and 16S rRNA Sequencing-Based Analysis on the Health Effects of Lacticaseibacillus paracasei XLK401 on Chicks

1. Introduction Since 2006, the European Union has prohibited the use of antibiotics in animal feed to boost growth [1]. This ban has resulted in a significant rise in disease outbreaks in broiler farming [2]. Therefore, there is an urgent need to find effective antibiotic alternatives for use in the…

Continue Reading Microorganisms | Free Full-Text | Genome-Wide and 16S rRNA Sequencing-Based Analysis on the Health Effects of Lacticaseibacillus paracasei XLK401 on Chicks

Genetic genealogy focus of Bryan Kohberger hearing in Idaho

Bryan Kohberger enters the courtroom in Latah County, Idaho, on Aug. 18, 2023, for a motion hearing. (Photo: Pool/Lewiston Tribune) DNA and investigative genetic genealogy took center stage Friday during a motions hearing in Bryan Kohberger’s quadruple murder case in Idaho. Prosecutors have asked Judge John Judge to issue a…

Continue Reading Genetic genealogy focus of Bryan Kohberger hearing in Idaho

Fails to build binary packages again after successful build

Source: lammps Version: 20220106.git7586adbb6a+ds1-2 Severity: minor Tags: trixie sid ftbfs User: lu…@debian.org Usertags: ftbfs-binary-20230816 ftbfs-binary-after-build User: debi…@lists.debian.org Usertags: qa-doublebuild Hi, This package fails to do build a binary-only build (not source) after a successful build (dpkg-buildpackage ; dpkg-buildpackage -b). This is probably a clear violation of Debian Policy section 4.9 (clean…

Continue Reading Fails to build binary packages again after successful build

Error (UUID) when compiling fitSNAP+LAMMPS – LAMMPS Installation

bqluan August 3, 2023, 4:49pm 1 Dear all,I hope to use the SNAP ML-potential in lammps. I followed the instructions here (2. Installation — FitSNAP documentation) for installation. However, I keep getting the error message near the end of compiling lammps:[100%] Built target lammps[100%] Building CXX object CMakeFiles/lmp.dir/u/bqluan/lammps/src/main.cpp.o[100%] Linking CXX…

Continue Reading Error (UUID) when compiling fitSNAP+LAMMPS – LAMMPS Installation

This federal team put the last few pieces into the human genome puzzle

Like so many projects, sequencing human genomes has gotten harder the closer the work came to completion. A National Institutes of Health team spent seven years heading up a worldwide consortium assembling the last 8% of the human genetic code. For its work, the team has made the finals of this…

Continue Reading This federal team put the last few pieces into the human genome puzzle

Gut microbiota analyses of inflammatory bowel diseases from a representative Saudi population | BMC Gastroenterology

Study populations Between 2015 and 2019, stool samples and data were collected from 219 IBD subjects (CD or UC) attending the Internal Medicine Clinics, King Fahd Hospital of the University, Al-Khobar and King Fahad Hospital, Alhafof, Saudi Arabia. Diagnosis of IBD was based on endoscopy (for CD) or colonoscopy (for…

Continue Reading Gut microbiota analyses of inflammatory bowel diseases from a representative Saudi population | BMC Gastroenterology

July 27, 2023, San Diego Metro Magazine

New Infinity Lab offers incubator to biotech startups By Brian Hiro | Cal State San Marcos When Thomas Lyle Temple began searching for lab space to house his biotech startup, he wasn’t exactly enamored with his options. Temple toured private facilities in the region that failed to meet his expectations…

Continue Reading July 27, 2023, San Diego Metro Magazine

Open Source Mathematical Software (Free app)

SageMath is a free open-source mathematics software system licensed under the GPL. It builds on top of many existing open-source packages: NumPy, SciPy, matplotlib, Sympy, Maxima, GAP, FLINT, R and many more. Access their combined power through a common, Python-based language or directly via interfaces or wrappers. Mission Creating a…

Continue Reading Open Source Mathematical Software (Free app)

LD search for multi-allelic variants

Of course. Here is an example: rs1557550 rs111368459 rs1632969 rs17206070 rs281861394 “ And all these variants present in my .bed file and are multi-allelic. To make my .bed files, I retained only the first instance of a variant when it was a multi-allelic variant that had multiple bi-allelic entries :…

Continue Reading LD search for multi-allelic variants

POP Biotechnologies and EuBiologics’ EuCorVac-19 COVID-19 Vaccine Hits Target in Phase 3 Trial

BUFFALO, NY / ACCESSWIRE / July 14, 2023 / POP Biotechnologies (POP BIO), a Buffalo, NY-based biopharmaceutical startup, announces top line interim results of a Phase 3 clinical trial of EuCorVac-19, a COVID-19 vaccine candidate being developed by South Korean partner EuBiologics (KOSDAQ: 206650). EuCorVac-19 is a protein-based vaccine consisting…

Continue Reading POP Biotechnologies and EuBiologics’ EuCorVac-19 COVID-19 Vaccine Hits Target in Phase 3 Trial

Pop Biotechnologies and Eubiologics’ Eucorvac-19 Vaccine Hits Target in Phase 3 Trial

POP Biotechnologies announced top line interim results of a Phase 3 clinical trial of EuCorVac-19, a COVID-19 vaccine candidate being developed by South Korean partner EuBiologics. EuCorVac-19 is a protein-based vaccine consisting of a vaccine antigen displayed on immunogenic nanoparticles, using POP BIO’s Spontaneous-nanoliposome antigen particle (SNAP) technology. The phase…

Continue Reading Pop Biotechnologies and Eubiologics’ Eucorvac-19 Vaccine Hits Target in Phase 3 Trial

main-amd64-default][science/lammps] Failed for lammps-2022.06.23.1_7 in build

You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: y…@freebsd.org Log URL: pkg-status.freebsd.org/beefy18/data/main-amd64-default/p8fb94260154e_s510fd83138/logs/lammps-2022.06.23.1_7.log Build URL: pkg-status.freebsd.org/beefy18/build.html?mastername=main-amd64-default&build=p8fb94260154e_s510fd83138 Log: =>> Building science/lammps build started at Fri Jul 14…

Continue Reading main-amd64-default][science/lammps] Failed for lammps-2022.06.23.1_7 in build

POP Biotechnologies and EuBiologics’ EuCorVac-19 COVID-19 Vaccine Hits Target in Phase 3 Trial

BUFFALO, N.Y., July 14, 2023 (Newswire.com) – POP Biotechnologies (POP BIO), a Buffalo, NY-based biopharmaceutical startup, announces top line interim results of a Phase 3 clinical trial of EuCorVac-19, a COVID-19 vaccine candidate being developed by South Korean partner EuBiologics (KOSDAQ: 206650). EuCorVac-19 is a protein-based vaccine consisting of a…

Continue Reading POP Biotechnologies and EuBiologics’ EuCorVac-19 COVID-19 Vaccine Hits Target in Phase 3 Trial

Using -r2 in plink1.9 with .bim file that has CHR:POS entries

Using -r2 in plink1.9 with .bim file that has CHR:POS entries 0 Hello, I have the following line of code: /Plink1.9/plink –bfile “${PLINK_REF_PANEL}/${chrom}”.final \ –r2 \ –ld-window 10000 \ –ld-window-r2 ${PLINK_MIN_R2} \ –keep “${PLINK_REF_PANEL_KEEP}” \ –out “${out_prefix}” \ –ld-snp-list “${SNAPTMP}/SNAP.input.proxy” \ > plink.${chrom}.r2.out #/dev/null And I have a .bim file…

Continue Reading Using -r2 in plink1.9 with .bim file that has CHR:POS entries

Differential interactions of selected phytocannabinoids with CYP2D6 polymorphisms

Phytocannabinoids (pCBs) refer to compounds from the cannabis plant (Cannabis sativa), also known as cannabinoids , we found that pCBs can be differentially metabolized by different cytochrome P450 (CYP) and different polymorphisms of human CYP2D6, In addition, inhibition or activation of enzymes involved in drug metabolism by pCB will in…

Continue Reading Differential interactions of selected phytocannabinoids with CYP2D6 polymorphisms

Genetic diversity of vector-borne pathogens in ixodid ticks infesting dogs from Pakistan with notes on Ehrlichia canis, Rickettsia raoultii and Dirofilaria immitis detection | Parasites & Vectors

Chomel B. Tick-borne infections in dogs—an emerging infectious threat. Vet Parasitol. 2011;179:294–301. Article  PubMed  Google Scholar  Dantas-Torres F, Otranto D. Best practices for preventing vector-borne diseases in dogs and humans. Trends Parasitol. 2016;32:43–55. Article  PubMed  Google Scholar  Zhang J, Liu Q, Wang D, Li W, Beugnet F, Zhou J. Epidemiological…

Continue Reading Genetic diversity of vector-borne pathogens in ixodid ticks infesting dogs from Pakistan with notes on Ehrlichia canis, Rickettsia raoultii and Dirofilaria immitis detection | Parasites & Vectors

Diagnostic performance of mNGS in identification of NTMPD

Introduction Non-tuberculous mycobacteria (NTM) is a collective name given to a group of more than 190 species of Mycobacterium other than Mycobacterium tuberculosis and Mycobacterium leprae.1 NTM are labeled as environmental mycobacteria as they are widely distributed in the environment, such as in soil, marshland, streams, rivers, estuaries, dust, domestic…

Continue Reading Diagnostic performance of mNGS in identification of NTMPD

LD analysis for SNPs in a list in plink2

Hi!  I have list of SNPs and I would like to find proxies for them by finding SNPs in LD with my “ld-snp-list”. Currently, it works on plink1.9. (my –keep argument is to specify a sub-ancestry). Here is my code: “ echo “proxy: Running PLINK LD analysis for chromosome ${CHROM}.”…

Continue Reading LD analysis for SNPs in a list in plink2

Downloading qiime2 on Ubuntu/WSL – Technical Support

Hello, I have been having issues installing qiime2 on windows. I read through the instructions on the website that said that downloading Windows subsystem for linux would be necessary. I also checked the forums and Francisco Cardenas provided a good guide up to a point. So following the Windows (via…

Continue Reading Downloading qiime2 on Ubuntu/WSL – Technical Support

amrfinder not working on loop?

amrfinder not working on loop? 0 Hi, i am trying to run amrfinder on multiple genome as in loop, and it gives following error, and whatever input file I am using in this program are also not shown after it run. #!/bin/bash **for k in /home/bvs/neelam/AMRFINDER_hypo/hyocool/*.fasta;do NAME=$(basename $k .fasta) echo…

Continue Reading amrfinder not working on loop?

Efflux pump gene amplifications bypass necessity of multiple target mutations for resistance against dual-targeting antibiotic

Strains and growth conditions All strains and plasmids used in this work are described in Supplementary Table 1. The clinical isolates were obtained from the Cystic Fibrosis Foundation Isolate Core at Seattle Children’s Hospital and were originally isolated from two different cystic fibrosis patients. Distribution of these isolates is covered by…

Continue Reading Efflux pump gene amplifications bypass necessity of multiple target mutations for resistance against dual-targeting antibiotic

Exogenously delivered iPSCs disrupt the natural repair response of endogenous MPCs after bone injury

Ethics statement All animal studies were performed in accordance with the recommendations in the Canadian Council on Animal Care Guidelines. The reporting of this data in the manuscript follows the recommendations in the ARRIVE guidelines. The University of Calgary Health Sciences Animal Care Committee approved all animal protocols and surgical…

Continue Reading Exogenously delivered iPSCs disrupt the natural repair response of endogenous MPCs after bone injury

MBA In Bioinformatics Jobs

MBA in Bioinformatics permits the scholars to analyze the utility of automatic know-how in accumulating and class of organic molecular genetics and genomes statistics for in addition processing and studies analysis. The applicants actively find out how useful the garage of this touchy statistics can cause undertaking of most important…

Continue Reading MBA In Bioinformatics Jobs

Full Form, Courses, Top Colleges, Syllabus, Admission, Fees, Jobs 2023-24

MBA in Bioinformatics permits the scholars to analyze the utility of automatic know-how in accumulating and class of organic molecular genetics and genomes statistics for in addition processing and studies analysis. The applicants actively find out how useful the garage of this touchy statistics can cause undertaking of most important…

Continue Reading Full Form, Courses, Top Colleges, Syllabus, Admission, Fees, Jobs 2023-24

Jupyterhub on kubernetes, hub stuck on pending, no error in describe pod – JupyterHub

Used the following commands to install kubernetes and the jupyterhub 2.0.0 from helm chart:sudo snap install microk8s –classic –channel=1.27sudo usermod -a -G microk8s rootsudo chown -f –R root ~/.kubesudo usermod -a -G microk8s ziadminsudo chown -f -R ziadmin ~/.kubemicrok8s enable dnsmicrok8s enable hostpath-storagemicrok8s enable helm3microk8s enable metallb:10.0.54.200-10.0.54.220sudo systemctl enable iscsid.servicemicrok8s…

Continue Reading Jupyterhub on kubernetes, hub stuck on pending, no error in describe pod – JupyterHub

A case report of cutaneous anthrax diagnosed with mNGS

Yushan Liu,1,2 Gezhi Zheng,1,3 Jing Li,1,3 Nan Yang,1– 4 Juan Li,1,2 Zhengwen Liu,1– 4 Qunying Han,1– 4 Yingren Zhao,1– 4 Fenjing Du,1,3 Yingli He,1,* Taotao Yan1,* 1Department of Infectious Diseases, The First Affiliated Hospital of Xi’an Jiaotong University, Xi’an, Shaanxi, People’s Republic of China; 2Institution of Hepatology, The First Affiliated…

Continue Reading A case report of cutaneous anthrax diagnosed with mNGS

tonb-dependent receptor plug, maker-scaffold139_size317827-snap-gene-2.25 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of tonb-dependent receptor plug vs. L. salmonis genes Match: EMLSAG00000004748 (supercontig:LSalAtl2s:LSalAtl2s24:993307:1011904:-1 gene:EMLSAG00000004748 transcript:EMLSAT00000004748 description:”maker-LSalAtl2s24-augustus-gene-10.16″) HSP 1 Score: 80.8777 bits (198), Expect = 8.252e-17Identity = 61/199 (30.65%), Postives = 98/199 (49.25%), Query Frame = 0 Query: 16 GANDVLVVAQEKG-DLLSTSMSLFVSKYANS—-SESGGRTVAMEVNDRKIGLKMTLNSRGIAAFARDEDKFRFRSREWKAVSIKPGINDGLYKVPSSGFEIKFSVFFIDMTKPLILVDLDASRPVDWEREYVAPFTGLEQDLDHIVKLCHKLSEDGQKEIVYLTDQIIVWDNSVRDDLFLKYQNRNGFSLPKGPVIL 209 G NDV++V Q G L ST…

Continue Reading tonb-dependent receptor plug, maker-scaffold139_size317827-snap-gene-2.25 (gene) Tigriopus kingsejongensis

Not annotated metagenome-assembled genomes recovered from rumen samples from cows

  Protozoa comprise a major fraction of the microbial biomass in the rumen microbiome, of which the genera Entodinium has been consistently observed to be dominant across a diverse genetic and geographical range of ruminant hosts. Despite the apparent core role that species such as Entodinium caudatum exert, their greater…

Continue Reading Not annotated metagenome-assembled genomes recovered from rumen samples from cows

Altered Transcriptional Response to Viruses in Duodenal Inflammation of CVID Patients

The following is a summary of “Duodenal inflammation in common variable immunodeficiency has altered transcriptional response to viruses,” published in the MARCH 2023 issue of Allergy & Immunology by Kaarbø, et al. Duodenal inflammation is common in patients with common variable immunodeficiency (CVID), but the underlying mechanisms remain unclear. While…

Continue Reading Altered Transcriptional Response to Viruses in Duodenal Inflammation of CVID Patients

Hacking A “Smart” Electric Toothbrush To Reset Its Usage Counter

The visible circuitry inside the brush head. Following the trend of stuffing more electronics in everyday devices, the new Philips Sonicare electric toothbrush that [Cyrill Künzi] purchased ended up having a ‘brush head replacement reminder’ feature that wasn’t simply a timer in the handle or base of the unit, but…

Continue Reading Hacking A “Smart” Electric Toothbrush To Reset Its Usage Counter

protein abrupt-like isoform x1, maker-scaffold97_size377342-snap-gene-2.14 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of protein abrupt-like isoform x1 vs. L. salmonis genes Match: EMLSAG00000011120 (supercontig:LSalAtl2s:LSalAtl2s753:207020:208693:1 gene:EMLSAG00000011120 transcript:EMLSAT00000011120 description:”augustus_masked-LSalAtl2s753-processed-gene-1.1″) HSP 1 Score: 342.043 bits (876), Expect = 1.286e-109Identity = 269/559 (48.12%), Postives = 311/559 (55.64%), Query Frame = 0 Query: 168 DNFGPSAPKRHRFNGPESRNSPSSSPKSLADWGRRSLEPKTEDTAEADNNNSTPKSESLLSQALEKHSNVSSMYDRHLLRDNGDGRDGDSASDTTSERPESLMDGLIKNSGAESELHRQLSAASPASMGGHLFPPGLEALYRQAGFPSAFLGLAAGAA—-GGSPGG————–PVSSMHGLASSVPQVGLQSHAGNPN—————————————–LAGKLDMMRVRATDPRPCPKCGKIYRSAHTLRTHMEDKHTICPGYRCVLCGTVAKSRNSLHSHMSRQHRGISTKDLPVLPMPSPFDPALASRLLAKAGVKVTPNELAARASPTAPRRSDLPKLDTNLLHM-HHHQFPLPPSLPT-SMSGHMGRGSHDGNGSDVEDLRVSSAPSPFGSNGGPGGIYSQAHQMRIAQGMLSPKDFA–ALASAGGAQGAAGMGSALLDTYLSMI-AAAGGDSNPMAAALNFQ-NPASRAAAFAAAAAAASGNQAHNGDGKDNDQRSGVSEDRDDMTGELGSDADNDDLSDNDD 661 D++ P PKRHR NG E…

Continue Reading protein abrupt-like isoform x1, maker-scaffold97_size377342-snap-gene-2.14 (gene) Tigriopus kingsejongensis

The first high-quality chromosome-level genome of the Sipuncula Sipunculus nudus using HiFi and Hi-C data

Cutler, E. B. The Sipuncula: Their Systematics, Biology, And Evolution (New York: Cornell University Press, doi.org/10.7591/9781501723643, 1994) Nielsen, C. Some aspects of spiralian development. Acta Zool. 91, 20–28, doi.org/10.1111/j.1463-6395.2009.00421.x (2010). Article  Google Scholar  Huang, D. Y., Chen, J. Y., Vannier, J. & Saiz Salinas, J. I. Early Cambrian sipunculan worms…

Continue Reading The first high-quality chromosome-level genome of the Sipuncula Sipunculus nudus using HiFi and Hi-C data

How the power of protein is being uncovered

Luke Alesbrook loads up the gas gun for the test The Light Gas Gun at the University of Kent is an unwieldy device which, to me, looks more like a lathe than a gun. Despite its lumbering appearance the gun can fire projectiles at a speed of 1.5km per second,…

Continue Reading How the power of protein is being uncovered

UPSC Key- May 18, 2023: Know about Snow leopard project, 1.5 degrees, QUAD, DNA Vaccines, L-G and aldermen

FRONT PAGE L-G can destabilise elected MCD with power to nominate Preliminary Examination: Indian Polity and Governance-Constitution, Political System, Panchayati Raj, Public Policy, Rights Issues, etc. Main Examination: General Studies II: Functions and responsibilities of the Union and the States, issues and challenges pertaining to the federal structure, devolution of powers and…

Continue Reading UPSC Key- May 18, 2023: Know about Snow leopard project, 1.5 degrees, QUAD, DNA Vaccines, L-G and aldermen

Introducing Slurm | Princeton Research Computing – SLURM Examples –

OUTLINE   On total of the cluster systems (except Nobel and Tigressdata), addicts run programs of submitting scripts into the Slurm mission scheduler. A Slurm script must execute three-way things: prescribe the resource requirements for the workplace set the environment specify the work to be carrying going in the form of cup commands Below…

Continue Reading Introducing Slurm | Princeton Research Computing – SLURM Examples –

Hospital Surveillance Sequencing Helps Link Cases to Nationwide Contaminated Eyedrop Outbreak

NEW YORK – A whole-genome sequencing (WGS)-based hospital outbreak surveillance program has helped researchers at the University of Pittsburgh to identify two drug-resistant Pseudomonas aeruginosa infections associated with a national outbreak of contaminated eyedrops. While the cases were ruled out as in-hospital transmissions, the findings illustrate the potential value of…

Continue Reading Hospital Surveillance Sequencing Helps Link Cases to Nationwide Contaminated Eyedrop Outbreak