Tag: SRF

AIIMS Mangalagiri MSc Life Sciences SRF Job Opening, Attend Walk-In AIIMS Mangalagiri MSc Life Sciences SRF Job Opening, Attend Walk-In. AIIMS Mangalagiri Senior Research Fellow Jobs. MSc Life Sciences SRF. Interested and eligible applicants can check out all of the details on the same below Hey there, AIIMS Mangalagiri is…

PhnD1 proteins in picocyanobacteria are lineage partitioned The predicted phosphonate-binding protein (PhnD1) under study is found within the genome of all 97 sequenced picocyanobacteria strains in the Cyanorak database, comprising cluster CK_860 [20]. While the gene encoding PhnD1 is highly conserved among all picocyanobacterial genomes, our phylogenetic tree reveals it…

DRDO Recruitment 2023: Check Posts, Age, Salary, Qualification and How to Apply DRDO Recruitment 2023: Defence Research and Development Organisation (DRDO) is looking eligible candidates for the post of Research Associate and Junior Research Fellowship (JRF). There are 09 vacant seats available for the mentioned post. As per the official…

Why 0/0 genotype refers to SNP and ALT != REF (in vcf file after freebayes) 1 Good morning, Could you please explain me, why 0/0 genotypes in vcf are SNPs? According to this description of GT: 0/0 the sample is a homozygous reference 0/1 the sample is heterozygous (carries both…

About PhD in Bioinformatics The Bioinformatics PhD is a three to five-year doctorate program. The PhD in Bioinformatics syllabus and subjects aims to provide in-depth knowledge in Computational Biology and Bioinformatics. PhD in Bioinformatics job scopes include a wide range of employment opportunities in public and private sectors. TABLE OF…

Home News Big opportunity for candidates looking for job in the agriculture sector. National Rice Research Institute (NRRI) is hiring candidates for various posts; check details below. ICAR- National Rice Research Institute (NRRI), Cuttack…

Wilkie AOM, Johnson D, Wall SA. Clinical genetics of craniosynostosis. Curr Opin Pediatr. 2017;29:622–8. Article  CAS  Google Scholar  Cornelissen M, Ottelander B, den, Rizopoulos D, van der Hulst R, Mink van der Molen A, van der Horst C, et al. Increase of prevalence of craniosynostosis. J Cranio-Maxillofac Surg. 2016;44:1273–9. Article …

programs for manipulating DNA sequencing files (usage examples) The io_lib from the Staden package is a library of file reading and writing code to provide a general purpose trace file (and Experiment File) reading interface. It has been compiled and tested on a variety of unix systems, MacOS X and MS…

This article was originally published here Viruses. 2022 Apr 10;14(4):787. doi: 10.3390/v14040787. ABSTRACT Risk stratification of coronavirus disease-19 (COVID-19) patients by simple markers is critical to guide treatment. We studied the predictive value of soluble interleukin-2 receptor (sIL-2R) for the early identification of patients at risk of developing severe clinical…

Hello to all I am trying to run bedtools intersect with vcf file and a bed file (my goal is to add the depth data to my VCF) I get an error running this command: bedtools intersect -a depth.bed -b fish.vcf -wa -wb > $out The error: “Error: Invalid record…

Associated RNAi Experiments Homology BLAST of hypothetical protein DAPPUDRAFT_213302 vs. L. salmonis genes Match: EMLSAG00000000401 (supercontig:LSalAtl2s:LSalAtl2s1063:86108:87342:-1 gene:EMLSAG00000000401 transcript:EMLSAT00000000401 description:”maker-LSalAtl2s1063-snap-gene-0.46″) HSP 1 Score: 149.443 bits (376), Expect = 4.121e-44Identity = 91/196 (46.43%), Postives = 119/196 (60.71%), Query Frame = 0 Query: 14 MDKITDLQVEPLT–NSRFVKPLRLRFKQDGKVKVWDLIQCHASVAVVIFNQTTQKFVFVRQFRPAVYFSALRRAQGDVEPGTQFKGDEIDPKVGITLELCAGIVD-KSKSLIEIAHEEILEETGYDVPMNLIEEIQTFPVGVGVGGENMTLFCAEVTEAMRKGPGGGLAEEGEMIDVIEMGVEETRTLMRAKSVT 206 MDK+ VEPL +SRFV P R+ ++Q+G…

University of Hyderabad recruiting Bioinformatics Research Associate Experienced(3 to 3+ Years) candidates candidates nearby Hyderabad.University of Hyderabad vacancies for Bioinformatics Research Associate is recruited through Written-test, Face to Face Interview etc. University of Hyderabad Company recruits a lot of Experienced(3 to 3+ Years) candidates candidates every year based on the…

Hey, I am looking for a way to add samples ID names to the FORMAT in my vcf file. I have 10 sorted Bam files. I used Freebayes to create vcf files and my next step is merging all 10 files for VcfSampleCompare. And for that I need to define…