Categories
Tag: SRF
Carbohydrates and carbohydrate degradation gene abundance and transcription in Atlantic waters of the Arctic
Seawater samples were collected from surface waters (SRF) and the bottom of the surface mixed layer (BML) in the Eastern Fram Strait region to investigate the distribution of carbohydrates and their utilisation by microbial communities. The ten sites were grouped into three categories based on the underlying seafloor topography (above-slope,…
Check Posts, Qualifications, Salary, Age, Selection Process and How to Apply
ICMR-NIIH Recruitment 2023: Check Posts, Qualifications, Salary, Age, Selection Process and How to Apply ICMR-NIIH Recruitment 2023: The Indian Council of Medical Research (ICMR)-National Institute of Immuno-Haematology (NIIH), Mumbai, is accepting applications from skilled and qualified candidates for the post of SRF. The chosen applicant will receive a monthly salary…
ICMR-NIIH Bioinformatics Job – Biotech, Microbiology, Biochem Job
“Exciting Job Opportunity in Bioinformatics at ICMR-NIIH: Apply Now for Biotech, Microbiology, and Biochem Positions!” ICMR-NIIH Bioinformatics Job – Biotech, Microbiology, Biochem Apply Online National Institute of Immunohaematology (NIIH), a part of the Department of Health Research under the Ministry of Health and Family Welfare, invites applications for the following…
ICGEB Bioinformatics SRF Job – Apply Online
“Apply Now for a High-Paying Bioinformatics Job at ICGEB – Limited Positions available!” ICGEB Bioinformatics SRF Job – Apply Online ICGEB – DBT PROJECT VACANCY The following vacancies are available in the project under Translational Bioinformatics Group, ICGEB, New Delhi, for a DBT-funded project. Shortlisted candidates will be invited for…
De novo reconstruction of satellite repeat units from sequence data
↵* Corresponding author; email: hli{at}jimmy.harvard.edu Abstract Satellite DNA are long tandemly repeating sequences in a genome and may be organized as high-order repeats (HORs). They are enriched in centromeres and are challenging to assemble. Existing algorithms for identifying satellite repeats either require the complete assembly of satellites or only work…
Senior Research Fellow/ICMR/SBST/Dr. R. Siva job with VELLORE INSTITUTE OF TECHNOLOGY
Job Description: Applications invited for the post of Senior Research Fellow (SRF) for an ICMR funded project entitled Project Title: “Circulating lineages of Burkholderia pseudomallei from clinical and environmental sources, and their direct identification using AI metabolite-MS database” FILE NO. BMI/12(49)/2022 Qualification: M.Sc/M.Tech Biotechnology/Bioinformatics/Computer science Required skills: Preferably candidates with 2 years of experience in…
Pseudogene MAPK6P4-encoded functional peptide promotes glioblastoma vasculogenic mimicry development
Gusyatiner, O. & Hegi, M. E. Glioma epigenetics: from subclassification to novel treatment options. Semin. Cancer Biol. 51, 50–58 (2018). Article PubMed Google Scholar Kunnakkat, S. & Narayana, A. Bevacizumab in the treatment of high-grade gliomas: an overview. Angiogenesis 14, 423–430 (2011). Article PubMed Google Scholar Luo, Q. et al….
Extracellular vesicles are the main contributor to the non-viral protected extracellular sequence space
Viromics datasets represent the sequence space of protected extracellular DNA (peDNA) The majority of samples prepared for “viromics” include GTAs and EVs, in addition to virus particles. All three entities are small protein- and/or lipid-containing particles that can enclose cellular DNA [3] or were found to bind cellular DNA on…
Senior Research Fellow/ICMR Funded Project /SBST/Dr. George Priya Doss C job with VELLORE INSTITUTE OF TECHNOLOGY
Job Description: Applications are invited for the post of Senior Research Fellow (SRF) for the ICMR Funded Project in School of Biosciences and Technology, VIT Vellore Title: To understand the impact of COVID-19 in host transcriptome and analyzing human genetic factors associated with susceptibility to SARS-CoV-2 infection FILE NO. VIR/COVID-19/31/2021/ECD-I Qualification: M. Tech Bioinformatics/Computational Biology…
Debian — Details of package staden-io-lib-examples in bookworm
programs for manipulating DNA sequencing files (usage examples) The io_lib from the Staden package is a library of file reading and writing code to provide a general purpose trace file (and Experiment File) reading interface. It has been compiled and tested on a variety of unix systems, MacOS X and MS…
Postdoctoral Researcher, the Fagerholm group job with UNIVERSITY OF HELSINKI
The Fagerholm group at the Molecular and Integrative Bioscience (MIBS) Research programme, Faculty of Biological and Environmental Sciences, University of Helsinki is seeking to recruit a POSTDOCTORAL RESEARCHER The position is available from 1st October 2023 for a minimum of 2 years with a possibility of extension. The postdoc will participate…
Biotecnika Instances E-newsletter 11.08.2023 Freshers Job Merck, Undertaking Intern, TIGS Hiring, Workshop Registrations Open + A lot Extra
Biotecnika Instances E-newsletter 11.08.2023 Freshers Job Merck, Undertaking Intern, TIGS Hiring, Workshop Registrations Open + A lot Extra Freshers Job at Merck – MSc Biotech, Biochem, Mol Bio & Microbiology Apply For Analyst Function President College Undertaking Intern With Pupil Assistantship For Life Sciences AIC-CCMB MSc Life Sciences Senior Science…
Biotecnika Times Newsletter 11.08.2023 Freshers Job Merck, Project Intern, TIGS Hiring, Workshop Registrations Open + Much More
Biotecnika Times Newsletter 11.08.2023 Freshers Job Merck, Project Intern, TIGS Hiring, Workshop Registrations Open + Much More Freshers Job at Merck – MSc Biotech, Biochem, Mol Bio & Microbiology Apply For Analyst Role President University Project Intern With Student Assistantship For Life Sciences AIC-CCMB MSc Life Sciences Senior Science Communicator…
CSIR-IICT MSc BTech Biotech, Bioinformatics, Microbiology, Mol Bio Project Jobs
CSIR-IICT MSc BTech Biotech, Bioinformatics, Microbiology, Mol Bio Project Jobs – Attend Walk-In NOTIFICATION NO. 11/2023 FOR WALK -IN-INTERVIEW CSIR – IICT is conducting Walk-in-Interview on 09.08.2023 for the following positions under various sponsored projects purely on temporary basis. Candidates who fulfill the under-mentioned criteria of age, educational qualifications, experience…
The Scleroderma Research Foundation (SRF) Launches Conquest Trial Platform to Address Critical Issues in Clinical Development and Enable Advances in Scleroderma Therapeutics
• Sanofi is inaugural partner • Initial focus on Interstitial Lung Disease Secondary to Scleroderma • SRF will submit and hold the IND as the trial Sponsor SAN FRANCISCO, August 01, 2023–(BUSINESS WIRE)–The Scleroderma Research Foundation (SRF), the nation’s largest non-profit funder of scleroderma research, today announced that Sanofi will…
Senior Research Fellow, in the field of Life Sciences, Bioinformatics, or Chemical Sciences. @ JNU – Jawaharlal Nehru University
Job Post: Senior Research Fellow (One) Summary: A temporary position is available for a Senior Research Fellow (SRF) in the field of Life Sciences, Bioinformatics, or Chemical Sciences. The SRF will be responsible for conducting research in mammalian cell culture, animal handling, medicinal chemistry, and drug discovery. The position is…
Reduced Vrk2 expression is associated with higher risk of depression in humans and mediates depressive-like behaviors in mice | BMC Medicine
The strategy and logic of choosing VRK2 SNPs for genetic analyses We retrieved the summary statistics of VRK2 SNPs in 23andMe, UK Biobank, and PGC2 samples [2, 3], and 256 SNPs region were available in all three GWAS datasets (a total of 246,363 cases and 561,190 controls). An overview about…
CSIR-IICT BSc, MSc, BTech Biotech, Life Sciences, Zoology, Microbiology, Bioinformatics Project Jobs, Attend Walk-In
CSIR-IICT BSc, MSc, BTech Biotech, Life Sciences, Zoology, Microbiology, Bioinformatics Project Jobs, Attend Walk-In NOTIFICATION NO. 10/2023 FOR WALK-IN-INTERVIEW CSIR – IICT is conducting Walk-in-Interview on 20.07.2023 for the following positions under various sponsored projects purely on temporary basis. Candidates who fulfill the under-mentioned criteria of age, educational qualifications, experience…
Integrated bioinformatics and wet-lab analysis revealed cell adhesion prominent genes CDC42, TAGLN and GSN as prognostic biomarkers in colonic-polyp lesions
Clinicopathological characteristics of patients with pre-cancerous lesions Clinicopathological features of the 20 included patients with colon polyps were extracted from their files and presented at the beginning of the survey. All resected samples were categorized into high-risk and low-risk polyps based on reported pathological feature of the samples. The mean…
Molecular and cellular evidence for the impact of a hypertrophic cardiomyopathy-associated RAF1 variant on the structure and function of contractile machinery in bioartificial cardiac tissues
The in vitro cellular reprogramming, differentiation, and tissue engineering of patient-derived samples reproducibly generated CBs and BCTs as human 3D disease models to investigate the molecular events contributing to cardiac dysfunction in RAF1-related NS. Patient-derived iPSCs and their isogenic gene-corrected controls are an invaluable source for CMs for human 3D…
NABI MSc, PhD Bioinformatics, Agriculture, Biotech, Biochem, Life Sciences Jobs
NABI Bioinformatics, Agriculture, Biotech, Biochem, Life Sciences Jobs For MSc, PhD – Attend Walk-In Don’t forget to check out possible interview questions for this job below 18Days11Hours09Minutes48Seconds National Agri-Food Biotechnology Institute (NABI)(Dept. of Biotechnology, Ministry of Science & Technology, Govt. of India)Sector-81, Knowledge City, Manauli P.O, S.A.S. Nagar-140306, Punjab, India.Website:…
AIIMS Mangalagiri MSc Life Sciences SRF Job Opening, Attend Walk-In in 2023
AIIMS Mangalagiri MSc Life Sciences SRF Job Opening, Attend Walk-In AIIMS Mangalagiri MSc Life Sciences SRF Job Opening, Attend Walk-In. AIIMS Mangalagiri Senior Research Fellow Jobs. MSc Life Sciences SRF. Interested and eligible applicants can check out all of the details on the same below Hey there, AIIMS Mangalagiri is…
Marine picocyanobacterial PhnD1 shows specificity for various phosphorus sources but likely represents a constitutive inorganic phosphate transporter
PhnD1 proteins in picocyanobacteria are lineage partitioned The predicted phosphonate-binding protein (PhnD1) under study is found within the genome of all 97 sequenced picocyanobacteria strains in the Cyanorak database, comprising cluster CK_860 [20]. While the gene encoding PhnD1 is highly conserved among all picocyanobacterial genomes, our phylogenetic tree reveals it…
Check Posts, Age, Salary, Qualification and How to Apply
DRDO Recruitment 2023: Check Posts, Age, Salary, Qualification and How to Apply DRDO Recruitment 2023: Defence Research and Development Organisation (DRDO) is looking eligible candidates for the post of Research Associate and Junior Research Fellowship (JRF). There are 09 vacant seats available for the mentioned post. As per the official…
Why 0/0 genotype refers to SNP and ALT != REF (in vcf file after freebayes)
Why 0/0 genotype refers to SNP and ALT != REF (in vcf file after freebayes) 1 Good morning, Could you please explain me, why 0/0 genotypes in vcf are SNPs? According to this description of GT: 0/0 the sample is a homozygous reference 0/1 the sample is heterozygous (carries both…
Course Details, Eligibility, Admission, Fees
About PhD in Bioinformatics The Bioinformatics PhD is a three to five-year doctorate program. The PhD in Bioinformatics syllabus and subjects aims to provide in-depth knowledge in Computational Biology and Bioinformatics. PhD in Bioinformatics job scopes include a wide range of employment opportunities in public and private sectors. TABLE OF…
Hurry Up! Apply for Agricultural Field Operator, SRF, JRF and Young Professional Posts
Home News Big opportunity for candidates looking for job in the agriculture sector. National Rice Research Institute (NRRI) is hiring candidates for various posts; check details below. ICAR- National Rice Research Institute (NRRI), Cuttack…
Clinical interest of molecular study in cases of isolated midline craniosynostosis
Wilkie AOM, Johnson D, Wall SA. Clinical genetics of craniosynostosis. Curr Opin Pediatr. 2017;29:622–8. Article CAS Google Scholar Cornelissen M, Ottelander B, den, Rizopoulos D, van der Hulst R, Mink van der Molen A, van der Horst C, et al. Increase of prevalence of craniosynostosis. J Cranio-Maxillofac Surg. 2016;44:1273–9. Article …
Debian — Details of package staden-io-lib-examples in bullseye
programs for manipulating DNA sequencing files (usage examples) The io_lib from the Staden package is a library of file reading and writing code to provide a general purpose trace file (and Experiment File) reading interface. It has been compiled and tested on a variety of unix systems, MacOS X and MS…
Soluble IL-2R Levels at Baseline Predict the Development of Severe Respiratory Failure and Mortality in COVID-19 Patients
This article was originally published here Viruses. 2022 Apr 10;14(4):787. doi: 10.3390/v14040787. ABSTRACT Risk stratification of coronavirus disease-19 (COVID-19) patients by simple markers is critical to guide treatment. We studied the predictive value of soluble interleukin-2 receptor (sIL-2R) for the early identification of patients at risk of developing severe clinical…
bedtools intersect error: Invalid record in file
Hello to all I am trying to run bedtools intersect with vcf file and a bed file (my goal is to add the depth data to my VCF) I get an error running this command: bedtools intersect -a depth.bed -b fish.vcf -wa -wb > $out The error: “Error: Invalid record…
hypothetical protein DAPPUDRAFT_213302, maker-scaffold2255_size18018-snap-gene-0.6 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of hypothetical protein DAPPUDRAFT_213302 vs. L. salmonis genes Match: EMLSAG00000000401 (supercontig:LSalAtl2s:LSalAtl2s1063:86108:87342:-1 gene:EMLSAG00000000401 transcript:EMLSAT00000000401 description:”maker-LSalAtl2s1063-snap-gene-0.46″) HSP 1 Score: 149.443 bits (376), Expect = 4.121e-44Identity = 91/196 (46.43%), Postives = 119/196 (60.71%), Query Frame = 0 Query: 14 MDKITDLQVEPLT–NSRFVKPLRLRFKQDGKVKVWDLIQCHASVAVVIFNQTTQKFVFVRQFRPAVYFSALRRAQGDVEPGTQFKGDEIDPKVGITLELCAGIVD-KSKSLIEIAHEEILEETGYDVPMNLIEEIQTFPVGVGVGGENMTLFCAEVTEAMRKGPGGGLAEEGEMIDVIEMGVEETRTLMRAKSVT 206 MDK+ VEPL +SRFV P R+ ++Q+G…
University of Hyderabad Recruitment 2021 – Bioinformatics Research Associate Government jobs in Hyderabad
University of Hyderabad recruiting Bioinformatics Research Associate Experienced(3 to 3+ Years) candidates candidates nearby Hyderabad.University of Hyderabad vacancies for Bioinformatics Research Associate is recruited through Written-test, Face to Face Interview etc. University of Hyderabad Company recruits a lot of Experienced(3 to 3+ Years) candidates candidates every year based on the…
FreeBayes VCF output with FORMAT unknown
Hey, I am looking for a way to add samples ID names to the FORMAT in my vcf file. I have 10 sorted Bam files. I used Freebayes to create vcf files and my next step is merging all 10 files for VcfSampleCompare. And for that I need to define…