Categories
Tag: SSL
Building Image with openssl – Installing and Using OpenWrt
Termy February 8, 2024, 10:59am 1 Hi there,i’m finally coming around to update to 23.05 and just want to make sure to not F* up something I want to keep TLS1.3 and thus openSSL. Of course, the image build fails if i just include libustream-openssl.It build successfully if i also…
Openapi.simfy.net Review: Legit or Scam?
Last Check: 20, January 2024 Check Openapi.simfy.net review to know whether it is a real or fake website. Get a detailed overview and understand Openapi.simfy.net legit or a scam. Openapi.simfy.net is an average website! Openapi.simfy.net has a safety score of 75 out of 100. The safety score is based on…
How to entry user-selectable page with Dockerlized Jupyterhub – JupyterHub
I am currently building JupyterHub on single machine using Docker, and I want users to access a page where they can select the Docker image they want upon logging in, like the below page. But whenever I log in using any account, the system always redirects me to the JupyterLab…
Undefined reference to mbedTLS functions – Nordic Q&A – Nordic DevZone
Hi all! So I’m trying to use mbedTLS methods in my project. I got it to work on SDK v1.9.0 but when upgrading to v.2.4.0 I get a lot of “undefined references” to methods regarding mbedTLS.I see that there is some other issues regarding this but those haven’t solved my…
URI encoding? “.” character in the LDAP authentication – Zero to JupyterHub on Kubernetes
Hello, members. When the user(jupyter.user contains . character) login, Expect behavior: create home jupyter.user Actual behavior: create home jupyter-2euser %2E means ., in the URI encode.So, I suspect Z2JH encodes some characters.Does anyone know how to fix it? hub: config: Authenticator: enable_auth_state: true JupyterHub: authenticator_class: ldapauthenticator.LDAPAuthenticator LDAPAuthenticator: server_address: ldapserver lookup_dn:…
Navigating TensorFlow Configuration in RStudio: A Guide for Diverse Environments | by Kamrul | Dec, 2023
1. Installing the Right Python Version Recommended Version: Python 3.10.x Optimal balance between new features and stability. Compatible with TensorFlow and avoids many common issues. Installation: Visit the Python website and select a 3.10.x version. Verification: python –version Troubleshooting: Ensure Python is correctly added to your system PATH. 2. Installing…
Senior Technical Marketing Manager at imperva
SENIOR TECHNICAL MARKETING MANAGER CYBER SECURITY is a big deal. It’s in the news, growing rapidly, a critical tool for every company, and our specialty. Imperva is a public company (NASDAQ) and cybersecurity leader that delivers best-in-class solutions to protect data and applications on-premises, in the cloud, and across hybrid…
python – Questioning a SQL database that contains doc chunks with keywords using vertex ai
Hello Stack Overflow Community, I am working on a project using Google Cloud services, specifically a Vertex AI Python notebook, and I need help with querying a PostgreSQL database to find the most similar text documents compared to a given keyword. The database contains chunks of text documents that were…
Cannot connect to the server, what am I missing? – JupyterHub
The hub on the host severed directly on my machine (not via docker image). I run the jupyterhub with command arg –debug, and got the terminal infomation as follows: root@DESKTOP-L60P4Q8:~/my_docker/main# jupyterhub –debug -f ../jupyterhub_config.py [D 2023-12-07 23:00:23.417 JupyterHub application:908] Looking for ../jupyterhub_config in /root/my_docker/main [D 2023-12-07 23:00:23.417 JupyterHub application:929] Loaded…
c – MBEDTLS_ERR_NET_INVALID_CONTEXT Error in mbedtls. Epoll gives EPOLLIN event notification when no data is available to read with TLS
I made a epoll HTTPS server with mbedtls. It listens on two ports: one for HTTP and the other is for HTTPS. The HTTP one works perfectly well. But for HTTPS I seem to get EPOLLIN notification when no data is available to read with mbedtls_ssl_read(). It could be that…
JupyterHub server spawning never completes; new JupyerHub admin – JupyterHub
Hello, I’ve recently started a position responsible for a JupyterHub installation as part of an HPC environment; the old team left without leaving much in the way of documentation, and I’ve never worked on JupyterHub before, so please bear with me. When launching JupyterHub, the system will stay on the…
AWS IoT core mbedtls error – Programming Questions
I’m trying to connect a weather station to an AWS IoT core server and I get the error “Arduino/libraries/WiFiClientSecure/src/ssl_client.h:7:10: fatal error: mbedtls/platform.h: No such file or directory” and I have no idea how to fix it, I’m using an r4 Wifi #include <WiFi.h> #include <WiFiClientSecure.h> #include <Wire.h> #include <Adafruit_Sensor.h> #include…
Web Technologies used by Pytorch-nlp.com
Overview of web technologies used by Pytorch-nlp.com. Website Background PyTorch 自然语言处理 PyTorch 自然语言处理文档包括自然语言处理(NLP)和深度学习,涵盖这两个领域的重要主题。 Description on Homepage not ranked Popularity rank MkDocs is a static site generator that’s geared towards building project documentation. MkDocs Static websites don’t use any server-side programming language for generating web pages, but deliver fixed content which…
Master The Pico WiFi: UDP For Speed
Article Index Master The Pico WiFi: UDP For Speed Sending data Page 1 of 2 What is the simplest of the TCP protocols? Answer UDP – it’s error- prone, but fast. This is an extract from our latest book on the Pico in C. Master the Raspberry Pi…
Redirect loop detected. Notebook has jupyterhub version unknown (likely < 0.8), but the Hub expects 4.0.2 - JupyterHub
Thanks very much for your help. I changed the jupyterhub_config.py to this: c.Spawner.args = [“–allow-root”] And run the jupyterhub, and there is the terminal information: I 2023-11-27 17:01:45.679 JupyterHub app:2859] Running JupyterHub version 4.0.2 [I 2023-11-27 17:01:45.679 JupyterHub app:2889] Using Authenticator: jupyterhub.auth.PAMAuthenticator-4.0.2 [I 2023-11-27 17:01:45.679 JupyterHub app:2889] Using Spawner: jupyterhub.spawner.LocalProcessSpawner-4.0.2…
Comparing Google Vertex AI vs AWS Sagemaker vs Amazon Bedrock
Generative AI platforms have transformed the landscape of machine learning, offering advanced models for natural language processing. In this comparison, we’ll explore three leading platforms, Google’s Vertex AI with PaLM2 model, AWS Sagemaker with Falcon-7b-instruct, and Amazon Bedrock with the AI21 Labs Jurassic-2Mid model.
Use select() with mbedtls library
I am creating a proxy using the mbedtls library. In the library itself, there are example how to read and write in the ssl socket, using for example mbedtls_ssl_read function. There is also a minimalistic client example, in the file ssl_client1.c. But I am stuck when I want to “wait…
nRF5340 mbedTLS Sockets SRAM Usage – Nordic Q&A – Nordic DevZone
I am using the nRF5340 on a board with an L2 ethernet chip (Microchip ENC424J600), and would like to support multiple MQTT+TLS1.2 connections using RSA or ECDSA certificates validation. I have enabled the mbedTLS library, and I am looking to support the following cipher suites: TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA384TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384 The Kconfig options below…
JupyterHub on Kubernetes cannot failed to cull user pods
I implemented JupyterHub using a Helm chart on a local Kubernetes cluster on VMware virtual machines. I want to cull users after they have been inactive for a while, but it seems not to work. This error log from the hub pod (pod named hub-545895f988-vmj2k) might be related: [W 2023-11-09…
mbedtls 3.5.1 – Download, Browsing & More
mbedtls 3.5.1 – Download, Browsing & More | Fossies Archive “Fossies” – the Fresh Open Source Software Archive Contents of mbedtls-3.5.1.tar.gz (8 Nov 12:36, 5580397 Bytes) About: Mbed TLS is a “portable, easy to use, readable and flexible” SSL library that implements cryptographic primitives, X.509 certificate manipulation and the SSL/TLS…
ALT Linux – sisyphus – mbedtls-3.5.1-alt1
Build time: Nov 9, 2023, 07:11 AM in the task #333966 Description: mbed TLS is a light-weight open source cryptographic and SSL/TLS library written in C. mbed TLS makes it easy for developers to include cryptographic and SSL/TLS capabilities in their (embedded) applications with as little hassle as possible. List of…
ALT Linux – sisyphus_riscv64 – mbedtls-compat-2.28.5-alt1
Description: mbed TLS is a light-weight open source cryptographic and SSL/TLS library written in C. mbed TLS makes it easy for developers to include cryptographic and SSL/TLS capabilities in their (embedded) applications with as little hassle as possible. List of rpms provided by this srpm: libmbedcrypto7 (riscv64) libmbedcrypto7-debuginfo (riscv64) libmbedtls-compat-devel (riscv64) libmbedtls14 (riscv64) libmbedtls14-debuginfo (riscv64)…
Activate cuda support for Pytorch / pipenv
I followed this answer to install Pytorch with cuda support in my pipenv (running on a Windows machine). My Pipfile looks like this: […] [[source]] name = “pytorch” url = “https://download.pytorch.org/whl/cu118” verify_ssl = false [packages] […] torch = {index = “pytorch”,version = “==2.1.0”} torchvision = {index = “pytorch”,version = “==0.16.0”}…
Container is gone after start – JupyterHub
Hi ! I try to mount a jupyterhub container. The server seems to run smoothly but cannot create a user notebook container (DockerSpawner). After a few seconds, the container disappears. Hereafter is my jupyterhub log (user: donzel): [D 2023-11-03 14:18:16.039 JupyterHub application:908] Looking for /srv/jupyterhub/jupyterhub_config in /srv/jupyterhub [D 2023-11-03 14:18:16.054…
Jupyterhub with AzureAD – JupyterHub
Hello, I’m trying to create docker image with azure ad login im able to login with my account after login in webpage i get Unhandled error starting server Username You can try restarting your server from the [home page]( Log D 2023-11-01 14:34:46.657 JupyterHub base:961] Initiating spawn for USER.Ext [D…
papain family cysteine protease containing protein, maker-scaffold1702_size30647-snap-gene-0.14 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of papain family cysteine protease containing protein vs. L. salmonis genes Match: EMLSAG00000006045 (supercontig:LSalAtl2s:LSalAtl2s327:400616:404607:-1 gene:EMLSAG00000006045 transcript:EMLSAT00000006045 description:”augustus_masked-LSalAtl2s327-processed-gene-4.0″) HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0Identity = 283/525 (53.90%), Postives = 368/525 (70.10%), Query Frame = 0 Query: 49 GHVARPLGKSPPNFVRDPPPRTTPPAQWLWNNVNETNFLTVSRNQHLPTYCGSCWAHAATSSLSDRIKIARQGAWPDINLAPQVLISCGPGDGCHGGEAGDANAYMHAQGITDETCSIYRARGQDNGLPCSKLEICSTCE—SKCYQPQHFFTYRVDEFHDVEGESNGEQEANMMAEIHHRGPISCGIAVTQALV-NYTGGLFHDKTGAQEIDHDISVVGYGVDEGTQEKYWLIRNSWGTYWGEQGFFRLIRGVNNLGIESGTCSWATPADTWSDAARE—RAAILSNEITLQKP——LWKQLWTVVADFVDNTRDTDLFRRLKLMQKGCKKLSSPRVPVVNIRPRPQDYVSTADLPEALDWRSVNGTNFLSWSVNQHLPVYCGSCWAQAGLSSLADRFTIADRKRFANLALSVQYILNCQAGGSCHGGDAFPLYAFIQKQGVPDVTCQPYEALDEGPLTDCSKPSKLVCKDCTWPPPEPGQEGNCWAKEKFHRYYVDEYNGVEGADNMKKEILERGPVT 560 GH+ R G+…
Fedora 37 : mbedtls (2023-e0ab860391) – vulnerability database
Fedora 37 : mbedtls (2023-e0ab860391) – vulnerability database | Vulners.com {“id”: “FEDORA_2023-E0AB860391.NASL”, “vendorId”: null, “type”: “nessus”, “bulletinFamily”: “scanner”, “title”: “Fedora 37 : mbedtls (2023-e0ab860391)”, “description”: “The remote Fedora 37 host has a package installed that is affected by a vulnerability as referenced in the FEDORA-2023-e0ab860391 advisory.\n\n – Mbed TLS 2.x…
JupyterHub in Docker Container with SSL – JupyterHub
diplo October 25, 2023, 7:56pm 1 I currently have a docker container with JupyterHub installed this was the command that I ran in order to create the container sudo docker run –gpus all -d -v /mnt:/mnt -p 8000:8000 –name jup_joker jup After running this I ran sudo docker exec -it…
JupyterHub redirect loop unknown version using SwarmSpawner – JupyterHub
I am attempting to configure JupyterHub with a SwarmSpawner, and I would like to get a functioning server that properly connects to the notebook swarm docker instances it launches. Upon accessing the URL of the JupyterHub server at the default port 8081 and spawning the image, the URL alternates between…
hiawatha 11.5 – Download, Browsing & More
hiawatha 11.5 – Download, Browsing & More | Fossies Archive “Fossies” – the Fresh Open Source Software Archive Contents of hiawatha-11.5.tar.gz (13 Oct 15:08, 1852032 Bytes) About: Hiawatha is a webserver with a focus on security (optimized for usage with PHP). Fossies downloads: / linux / www / hiawatha-11.5.tar.gz (tar.bz2|tar.xz|zip) Fossies services:…
python – Cannot download Pytorch
I have been trying to download Pytorch for use with Automatic1111 but am getting the error below. This error also occurs when trying to install pytorch via the commandline using python -m pip –default-timeout=600 install torch==1.13.1+cu117 torchvision==0.14.1+cu117 –extra-index-url download.pytorch.org/whl/cu117 –no-cache-dir The Python version I have is 3.10.6 and I have…
Fedora alert FEDORA-2023-5c6521d81d (mbedtls) [LWN.net]
From: updates@fedoraproject.org To: package-announce@lists.fedoraproject.org Subject: [SECURITY] Fedora 38 Update: mbedtls-2.28.5-1.fc38 Date: Fri, 13 Oct 2023 01:53:45 +0000 Message-ID: <20231013015345.4264B2051171@bastion01.iad2.fedoraproject.org> Archive-link: Article ——————————————————————————– Fedora Update Notification FEDORA-2023-5c6521d81d 2023-10-13 01:51:39.405973 ——————————————————————————– Name : mbedtls Product : Fedora 38 Version : 2.28.5 Release : 1.fc38 URL…
Z2jh 500 : Internal Server Error – Zero to JupyterHub on Kubernetes
I have installed z2jh on a local k8s cluster. Sometimes I get 500 error, other times it works fine.I’m using jupyterhub Version 3.0.0, helm chart 2.0.0 500 : Internal Server ErrorThe error was:Failed to connect to Hub API at ‘hub:8081/hub/api’. Is the Hub accessible at this URL (from host: jupyter-hammad-20ali-20baig)?…
Mbedtls change buffer size – Programming Questions
HelloI am using ESP32 to connect to a https server and send some data using wificlientsecure. everything works as expected, but the project is quite big and I don’t have much heap left. AFAIK mbedtls uses 16k buffer for in and out buffer, which is too much as I am…
mbedtls 3.5.0 – Download, Browsing & More
mbedtls 3.5.0 – Download, Browsing & More | Fossies Archive “Fossies” – the Fresh Open Source Software Archive Contents of mbedtls-3.5.0.tar.gz (5 Oct 00:47, 5613738 Bytes) About: Mbed TLS is a “portable, easy to use, readable and flexible” SSL library that implements cryptographic primitives, X.509 certificate manipulation and the SSL/TLS…
ALT Linux – sisyphus – mbedtls-3.5.0-alt1
Собран: 6 октября 2023 г. 13:09 в задании #331087 Описание: mbed TLS is a light-weight open source cryptographic and SSL/TLS library written in C. mbed TLS makes it easy for developers to include cryptographic and SSL/TLS capabilities in their (embedded) applications with as little hassle as possible. Список rpm-пакетов, предоставляемых данным…
Grafana Introduces ML Tool Sift to Improve Incident Response
Grafana Labs has introduced Sift, a feature for Grafana Cloud designed to enhance incident response management (IRM) by automating system checks and expediting issue resolution. Sift automates various aspects of incident investigation, including identifying error log patterns, detecting Kubernetes container crashes, spotting overloaded hosts, monitoring recent deployments, tracking resource contention,…
Jupyterhub-singleuser consuming significant and constant CPU – JupyterHub
akrherz September 13, 2023, 3:45pm 1 I’m using python 3.11 + jupyterhub 4.0.2 + jupyterlab 4.0.5 and am currently having a problem with jupyterhub-singleuser consuming constant and high CPU even when the user is not connected to the web console. I am launching it like so via jupyterhub_config.py c.Spawner.cmd =…
A self-supervised deep learning method for data-efficient training in genomics
Self-GenomeNet is an efficient self-supervised pre-training method, tailored for genomics Self-GenomeNet is a SSL method, where the network is trained without the need of labels on available sequential genome data. Then this network, particularly the trained weights of this network, can be used as the initial point of the model…
Error while installing tensorflow and PyTorch – Python Help
ERROR: Exception:Traceback (most recent call last):File “C:\Users\Vaishnavi Gulave\AppData\Roaming\Python\Python310\site-packages\pip_vendor\urllib3\response.py”, line 437, in _error_catcheryieldFile “C:\Users\Vaishnavi Gulave\AppData\Roaming\Python\Python310\site-packages\pip_vendor\urllib3\response.py”, line 560, in readdata = self._fp_read(amt) if not fp_closed else b””File “C:\Users\Vaishnavi Gulave\AppData\Roaming\Python\Python310\site-packages\pip_vendor\urllib3\response.py”, line 526, in _fp_readreturn self._fp.read(amt) if amt is not None else self._fp.read()File “C:\Users\Vaishnavi Gulave\AppData\Roaming\Python\Python310\site-packages\pip_vendor\cachecontrol\filewrapper.py”, line 90, in readdata = self.__fp.read(amt)File “C:\Users\Vaishnavi Gulave\AppData\Local\Programs\Python\Python310\lib\http\client.py”, line…
How-to use C# openapi-generator without SSL
I’m using openapi-generator to create a C# class for accessing a REST API. This REST API is http and does not have a SSL certificate. The generated C# class was done by this command java -jar ./openapi-generator-cli.jar generate -g csharp -i ../../openapi.yaml -o cn_http_client_csharp –additional-properties=artifactId=http-client –additional-properties=io.swagger.parser.util.RemoteUrl.trustAll=true –additional-properties=io.swagger.v3.parser.util.RemoteUrl.trustAll=true –skip-validate-spec When testing…
Java8 FIPS client connection to K8s server – General Discussions
We have RHEL8 FIPS enabled OS linux machines ( Red Hat Enterprise Linux release 8.8 (Ootpa), 4.18.0-477.13.1.el8_8.x86_64 #1 SMP Thu May 18 10:27:05 EDT 2023 x86_64 x86_64 x86_64 GNU/Linux ) and have a very simple java client running on that machine to connect to K8s client to list the pods….
JupyterHub and another web application behind Nginx – JupyterHub
Hi! I have installed TLJH on a server, along with a web application (Django). I am now trying to run both TLJH and the web application behind a Nginx reverse proxy on the same domain name. TLJH will be accessible with a different location (e.g. my-domain/jupyter). Currently, only the web…
DockerSpawner breaks with 302 response from unmodified jupyterhub/jupyterhub-deploy-docker.git repo – JupyterHub
Hi JupyterHub community, I am trying to deploy JupyterHub with DockerSpawner to a fresh Ubuntu 22 LTS VM, however I am running into problems. Can someone give me a pointer to how I may debug this? Should I file an issue with the jupyterhub Github repo, or might it be…
PC Command Mode – Profound Logic Documentation
Use this configuration option to choose the PC program that starts PC commands. Starting with Profound UI Version 5, Fix Pack 13.0, this configuration option overrides pui[“use pc listener”] and pui[“pc listener mode”]. The option expects string values: “listener_m2” – Profound UI uses the PC Command Listener in Mode 2,…
SSL: DECRYPTION_FAILED_OR_BAD_RECORD_MAC in NPM and Python
Whenever I download any decent sized package in npm or python, I receive following error [SSL: DECRYPTION_FAILED_OR_BAD_RECORD_MAC] decryption failed or bad record mac Here is complete stack trace of error, (Roaya_Test) E:\AI\Roaya\AI_Test_Scripts\Data>kaggle datasets download -d minhajuddinmeraj/anomalydetectiondatasetucf Downloading anomalydetectiondatasetucf.zip to E:\AI\Roaya\AI_Test_Scripts\Data … resuming from 20971520 bytes (41001681567 bytes left) … 0%|…
Jupyterhub 4.0.x with jupyter-collaboration – JupyterHub
Hi, Did anyone have success of using the latest Jupyterhub with jupyter-collaboration extension? For some reason I get WebSocket errors when trying to use the server link with a token in a private browser window. This worked previously with Jupyterhub 3.1.1. Here a quick test: Dockerfile: FROM jupyter/minimal-notebook:hub-4.0.2 RUN pip…
Error RStudio peer certificate – OSM Help
Hi, I cannot use OSM to getbb() in RStudio. The error response is: Peer certificate cannot be authenticated with given CA certificates: [nominatim.openstreetmap.org] SSL certificate problem: certificate has expired Backtrace: 1. osmdata::getbb(“Montevideo, Uruguay”) 2. osmdata:::get_nominatim_query(…) 3. httr2::req_perform(req) 4. base::tryCatch(…) 5. base (local) tryCatchList(expr, classes, parentenv, handlers) 6. base (local) tryCatchOne(expr,…
Mqtt Client Timeout Issue – HiveMQ Community Edition
Rahul August 10, 2023, 5:29am 1 HI Everyone, I have trying to connect on-premise hivemq broker from firmware code and I’m getting always below image error. Even though we have made changes in broker configuration by increasing no-connect-idle-timeout-mills to 90 sec. Still struggling with same issue. Broker config.xml <mqtt> <no-connect-packet-idle-timeout-millis>90000</no-connect-packet-idle-timeout-millis>…
ALT Linux – sisyphus – mbedtls-compat-2.28.4-alt1
Build time: Aug 4, 2023, 07:03 PM in the task #326428 Description: mbed TLS is a light-weight open source cryptographic and SSL/TLS library written in C. mbed TLS makes it easy for developers to include cryptographic and SSL/TLS capabilities in their (embedded) applications with as little hassle as possible. List of…
mbedtls LPCXpresso55S16 – NXP Community
Hello, Greetings, I am currently attempting to establish a connection between the LPCXpresso55S16 (acting as a server) and the Raspberry Pi (acting as a client) via DTLS using the mbedtls library. Unfortunately, during the handshake process, I encountered an issue where the ssl_parse_client_key_exchange function returns a negative value, causing the…
ggplot dot plot by group
If you don’t like that add scales=”free_y”: Thanks for contributing an answer to Stack Overflow! # y axis isn’t really meaningful, so hide it, # Examples with stacking along y axis instead of x, # binpositions=”all” ensures that the bins are aligned between groups, # Stacking multiple groups, with different…
Self-signed certificates for Jupyter URI (Support Jupyter Hub)
Self-signed certificates for Jupyter URI (Support Jupyter Hub) Jupyter. Connecting to a Jupyter server via https with a self-signed certificate fails: Failed to connect to remote Jupyter notebook. Read more > Note: Self-Signed SSL Certificate for (local) JupyterHub In this note I’ll go through creating self-signed SSL certificates and adding…
Unable to start notebook/stuck – JupyterHub
moloch July 28, 2023, 12:41am 1 Hi there, We had a previous installation of jupyterhub 2.3.1 which was working nicely. We did upgrade to 4.0.1 however post that we are having two issues. One note, we are using Okta to do SAML authenication. New users are getting an message:403 :…
Modifying the vdb-config to increase timeout in a docker image
This the docker image I want to modify. My objective is to include this in the container in other words increase timeout # set timeout to 10 seconds $ vdb-config -s /http/timeout/read=10000 So Steps what I have done is – docker pull biomystery/sra-tools-pigz:2.10.9 – docker run -it -d –name kcm_sra_tool…
Error: L6449E: While processing /workspace/CMSIS-OUTPUT/: I/O error writing file ‘/workspace/CMSIS-OUTPUT/’: Is a directory – Keil forum – Support forums
Following error has been returned in my Keili Studio Cloud environment: — FAILED: /workspace/CMSIS-OUTPUT/Demo.elf : && /opt/AC6/bin/armlink –cpu=Cortex-M55 –scatter=”/workspace/workspace/aws_mqtt_mutualauth_demo/Board/AVH_MPS3_Corstone-300/RTE/Device/SSE-300-MPS3/fvp_sse300_mps3_s.sct” –import-cmse-lib-out “/workspace/CMSIS-OUTPUT/” –entry=Reset_Handler –diag_suppress 6314,6848 CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-Driver/2.7.2/ETH/ETH_LAN91C111.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/CMSIS/RTOS2/FreeRTOS/Source/ARM/clib_arm.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/CMSIS/RTOS2/FreeRTOS/Source/cmsis_os2.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/CMSIS/RTOS2/FreeRTOS/Source/freertos_evr.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/CMSIS/RTOS2/FreeRTOS/Source/os_systick.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/event_groups.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/list.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/portable/GCC/ARM_CM33_NTZ/non_secure/port.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/portable/GCC/ARM_CM33_NTZ/non_secure/portasm.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/portable/MemMang/heap_5.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/queue.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/stream_buffer.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/tasks.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/CMSIS-FreeRTOS/10.4.6/Source/timers.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/V2M_MPS3_SSE_300_BSP/1.2.0/Board/Device_Definition/device_definition.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/V2M_MPS3_SSE_300_BSP/1.2.0/CMSIS_Driver/Driver_USART.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/V2M_MPS3_SSE_300_BSP/1.2.0/Native_Driver/arm_mps3_io_drv.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/V2M_MPS3_SSE_300_BSP/1.2.0/Native_Driver/uart_cmsdk_drv.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/mbedTLS/1.7.0/MDK/library/entropy_poll_hw.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/mbedTLS/1.7.0/MDK/library/iot_socket/net_sockets.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/mbedTLS/1.7.0/library/aes.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/mbedTLS/1.7.0/library/arc4.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/mbedTLS/1.7.0/library/aria.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/mbedTLS/1.7.0/library/asn1parse.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/mbedTLS/1.7.0/library/asn1write.o CMakeFiles/Demo.dir/tmp/.cache/arm/packs/ARM/mbedTLS/1.7.0/library/base64.o…
Running singleuser from JupyterHUb via Slurm does not connect Hub – JupyterHub
Description I am trying to start Notebook via Slurm on JupyterHub.The Slurm job is running and the Notebook is up and running, but the Hub screen still says “Cluster job Running … Waiting to connect” is still displayed on the Hub screen.It then times out and exits. Note that JupyterHub,…
cuda – Failing to install PyTorch
I am trying to install PyTorch in a conda environment to use diff-svc software. But for some reason it fails, I get this error: (diff-svc) C:\Users\larsh>conda install pytorch torchvision torchaudio pytorch-cuda=11.7 -c pytorch -c nvidia Collecting package metadata (current_repodata.json): failed CondaSSLError: OpenSSL appears to be unavailable on this machine. OpenSSL…
131releng-armv7-quarterly][biology/htslib] Failed for htslib-1.17 in build
You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: j…@freebsd.org Log URL: pkg-status.freebsd.org/ampere1/data/131releng-armv7-quarterly/bee14067723b/logs/htslib-1.17.log Build URL: pkg-status.freebsd.org/ampere1/build.html?mastername=131releng-armv7-quarterly&build=bee14067723b Log: =>> Building biology/htslib build started at Mon Jul 10…
Cannot load DESeq2 package – General
Dear Community,(Disclaimer : I learned R two weeks ago so most probably a very nooby question)I have run the follwing code to install DESeq2 based on the advice of my Post-Doc: BiocManager::install(c(“DESeq2″,”EnhancedVolcano”,”apeglm”)) Everything seemed fine except for DESeq2 where I had an issue with dependcy for the “RCurl” package that…
python – SSL/urllib error while running code on kaggle-editor
link to specific notebook :- www.kaggle.com/code/hamedghorbani/plant-disease-classification-fine-tuned-99-3 gaierror Traceback (most recent call last) File /opt/conda/lib/python3.10/urllib/request.py:1348, in AbstractHTTPHandler.do_open(self, http_class, req, **http_conn_args) error occured in this part of the code # Load the pretained model pretrained_model = tf.keras.applications.EfficientNetB5( input_shape=(224, 224, 3), include_top=False, # we don`t need a pre-trained top layer (output layer) weights=”imagenet”,…
RStudio Server Professional Edition 1.3.952-1
Logging In By default RStudio Server runs on port 8787 and accepts connections from all remote clients. After installation you should therefore be able to navigate a web browser to the following address to access the server: <server-ip>:8787 RStudio will prompt for a username and password and will authenticate access…
Web Connection | [OpenAPI Setting]
Sets the port number of this system to communicate via OpenAPI. Range: 1 to 65535 Default: 50001 Sets SSL/TLS encryption communication. This function is displayed when the certificate is installed. [SSL Only] is not selectable when the middle server authentication or a combination of the external server authentication and middle…
Diff – d68434efbad8465e388ee5cc86cb28253f2539fa^! – mirror/mbed-tls
Disable some tests with valgrind Tends to cause spurious failures on buildbots due to peer timing out. Anyway, those tests are mainly for interop, any memory error is most likely catched by some earlier self-op test. (Also, we’ll run these tests with ASan anyway.) diff –git a/tests/ssl-opt.sh b/tests/ssl-opt.sh index dadadf5..bd36e22…
How to merge BLE_UART and Aes_ctr project file – Nordic Q&A – Nordic DevZone
Hello, I have two project one is Ble UART and second AES_ctr, i want to combine AES_ctr project and sdk_config.h file into BLE_UART ,so i can use AES API in BLE UART code can you guide me how to start it. <!DOCTYPE CrossStudio_Project_File> <solution Name=”nrf_crypto_aes_ctr_pca10056″ target=”8″ version=”2″> <project Name=”nrf_crypto_aes_ctr_pca10056″> <configuration …
CubeMx, FreeRTOS, LwIP and MBEDTLS – mbedtls_callo…
Hello, I’ve generated simple SSL Client example from CubeMX using FreeRTOS, MBED TLS and LwIP components. I’d like to connect to SSL server (test server present in CubeF4 package). I have pretty similar default settings for these components from CubeMX. Obviously I don’t have memory available, or maybe something is…
Recent FDA Actions: June 2023
FDA Approves Enfortumab Vedotin Plus Pembrolizumab for Locally Advanced or Metastatic Urothelial Carcinoma The FDA has granted accelerated approval to enfortumab vedotin-ejfv (Padcev) plus pembrolizumab (Keytruda) for patients with locally advanced or metastatic urothelial carcinoma who are not eligible for cisplatin-containing chemotherapy.1 The regulatory decision was supported by data from the…
MbedTLS Handshake failing between client & server (v 3.4.0) – Bug Reports / Issues
Hello, I’m trying to develop an application using MbedTLS SSL libraries that encrypts data exchange between client & server using PSK based TLS 1.2. Turns out that client side is crashing while trying to send the change cipher spec message during TLS handshake. Crash:signal 6 (SIGABRT), code -1 (SI_QUEUE), fault…
Jupyterhub Remote user local authentication – JupyterHub
ankit June 13, 2023, 10:32am 1 I am using Jupyterhub Remote user local authenticator. I have configured Azure AD authentication in AWS ELB after successful authentication I am getting three headers as returned by AWS (x-amzn-oidc-accesstoken, x-amzn-oidc-data, x-amazn-oidc-identity). But none of them have desired value directly in headers as we…
Was data of lakhs of users leaked? Centre breaks silence, dismisses rumours
CoWIN data breach: Was data of lakhs of users leaked? Centre breaks silence (File photo) After reports of an alleged CoWIN data breach broke out, the Central government stepped forward to issue an official statement regarding the same, saying that the data of lakhs of Indians who have their details…
mbedtls – Mbed TLS Handshake retransmission issue – PC based client and STM32H7 based server
I am working on setting up a USB based secure communication between PC as client and STM32H753 microcontroller running a SSL Server. The network stack used is LwIP and Mbed TLS (TLS v1.2) is used for the secure communication layer. I adapted this using the SSL_Server example available and used…
scripts/generate_errors.pl – third_party/github.com/ARMmbed/mbedtls – Git at Google
#!/usr/bin/env perl # Generate error.c # # Usage: ./generate_errors.pl or scripts/generate_errors.pl without arguments, # or generate_errors.pl include_dir data_dir error_file use strict; my ($include_dir, $data_dir, $error_file); if( @ARGV ) { die “Invalid number of arguments” if scalar @ARGV != 3; ($include_dir, $data_dir, $error_file) = @ARGV; –d $include_dir or die “No such…
Communication & Information Technology Regulatory Authority Companies that have the official permission to be a cloud computing provider
1 ACC-8543 Compute: App Engine Managed app platform Bare Metal Solution Hardware for specialized workloads Cloud Functions Event-driven serverless functions Cloud…
Christian Mills – Hands-On Hand Gesture Recognition: Fine-Tuning Image Classifiers with PyTorch and the timm library for Beginners
Introduction Welcome to this hands-on guide to fine-tuning image classifiers with PyTorch and the timm library! Fine-tuning refers to taking a pre-trained model and adjusting its parameters using a new dataset to enhance its performance on a specific task. We can leverage pre-trained models to achieve high performance even when…
fastq-dump – connection failed
fastq-dump – connection failed 1 Hi, I need to install a specific RNA sequence data using sra toolkit. I installed the toolkit using this command: sudo apt install sra-toolkit Then confirmed installation by which fastq-dump and got this /usr/bin/fastq-dump But when downloaded SRR21627290 fastq-dump –stdout -X 2 SRR21627290 I got…
Authentication Types [Connected Systems]
Overview HTTP and OpenAPI connected systems allow you to manage authentication details for various third-party integrations in one place. This page details the authentication options available from the Authentication dropdown list in these connected systems. All fields marked Sensitive will never be logged as part of HTTP request/response logging for…
Cannot connect to Postgres database from RStudio but can connect from DBeaver and psql
Can connect to the database from psql and DBeaver but when using RpostgreSQL package in RSudio I receive the following error: RPosgreSQL error: could not connect user@hostname on dbname “database”: FATAL: no pg_hba.conf entry for host “”, user “user_name”, database “databse”, SSL off Macbook Pro ’21, M1, macOS Monterey Here…
mbedtls-platform-support 0.1.0 on Cargo – Libraries.io
This is an idiomatic Rust wrapper for MbedTLS, allowing you to use MbedTLS with only safe code while being able to use such great Rust features like error handling and closures. Additionally, building on MbedTLS’s focus on embedded use, this crate can be used in a no_std environment. Building This…
Prefecth-orig and fasterq-dump not working when downloading SRA files (v3.0.5)
Hi everyone! I am having some problems when I try to download SRA files. Yesterday I was trying to download a set of SRA files using SRA Toolkit 3.0.2 and it didn’t work. I thought that it was a problem with the version, so I just installed the new one…
Master The Pico WiFi: Simplest HTTPS Client
Page 1 of 4 What is the simplest HTTPS client you can create using lwIP and mbedtls? The answer is very simple indeed. This is an extract from our latest book on the Pico in C. Master the Raspberry Pi Pico in C:WiFiwith lwIP & mbedtls By…
Compilation Fail – Nordic Q&A – Nordic DevZone
ncs 2.3.0 Good morning,for a few days, I can no longer compile a firmware that I use regularly. I don’t understand what could have happened. I’ll post the compilation with the errors if anyone has any ideas about it.Thank you CMAKE/BUILD [cmake] CMake Error at /opt/nordic/ncs/v2.3.0/zephyr/cmake/modules/extensions.cmake:2520 (message): [cmake] BOARD is not…
Change default JupyterLab working directory – JupyterLab
HI, I’m a total noob here so please go easy on me. My goal is to have JupyterHub/JupyterLab running on Docker inside an Azure Container Instance, and have a persistent Azure File Share mounted to the container instance. Some background. I’m using Docker Desktop (windows) to create the image. Then…
How to improve security in nginx bloc for jupyterhub – discuss
arnome April 26, 2023, 3:47pm 1 Hi everyone, I have set up a jupyterhub server with nginx as reverse proxy. I start making the nginx bloc configuration file using the one give in the official documentation and I add some rules to « harding nginx ». This is the current…
connection failed and certificated verification failed in fastq-dump
Error: connection failed and certificated verification failed in fastq-dump 0 I am currently using Ubuntu-18.04 on wsl2. I saved ext4.vhdx on my D: drive and linked the path to it (to solve the problem of data capacity). After that, I tried to use sra-toolkit for ‘fastq-dump –stdout -X 2 SRR390728’,…
Oauth state missing from cookies – JupyterHub
Hi, I install jupyterhub in my vm machine,also i done with ssl and sso of jupyterhub with keycloak.and its working smoothly. Now i want to embed jupyterhubin my angular application for that i have added following code to jupyterhub_config.py file. I was able to see jupiterhub in my angular application…
kubernetes – Connection to dask gateway server fails with JupyterHub authentication
I am doing a multi user setup with DaskHub and JupyterHub with the use of Daskgateway servers but my connection to dask-gateway servers fails with error: Error ClientConnectorError: Cannot connect to host traefik-dask-gateway:80 ssl:default [Name or service not known] Connection string used: from dask_gateway import Gateway gateway = Gateway( address=”http://traefik-dask-gateway/services/dask-gateway/”,…
Promethease Login – EnewResult
Promethease Login is a sophisticated online platform that enables users to obtain a comprehensive overview of their genetic data. Powered by the raw data of genetic testing from providers such as 23andMe, AncestryDNA, and others, Promethease Login allows users to access a wealth of information about their health traits, ancestry,…
openssl – Unable to install Rstudio after reinstalling R
Rstudio showed me a newer version, so I downloaded and installed it, but it refused to start afterwards, I removed and reinstalled R and Rstudio, the error persists. This is the error it gives me: ## R Session Startup Failure Report ### RStudio Version RStudio 2023.03.0+386 “Cherry Blossom ” (3c53477a,…
psa_generate_key failed! with Error: -134 – Nordic Q&A – Nordic DevZone
Hi nordic team, I am working on an application which uses crypto cell feature, wifi capability of nrf7002DK, mbedTLS etc. I proceeded my development after individually verifying each features on nrf7002dk (crypto cell, wifi, mbedTLS etc). My current problem is that, psa_generate_key() failed to generate key and returns error code of…
FDA Approves Polatuzumab Vedotin Plus R-CHP for Previously Untreated DLBCL
The FDA has approved polatuzumab vedotin-piiq (Polivy) plus rituximab (Rituxan), cyclophosphamide, doxorubicin, and prednisone (R-CHP) for use in adult patients who have previously untreated diffuse large B-cell lymphoma (DLBCL), not otherwise specified (NOS) or high-grade B-cell lymphoma (HGBL) and who have an International Prognostic Index score of two or greater.1…
Master The Pico WiFi: Simplest HTTP Client
Page 1 of 4 What is the simplest HTTP client you can create using lwIP? The answer is very simple indeed. This is an extract from our latest book on the Pico in C. Master the Raspberry Pi Pico in C:WiFiwith lwIP & mbedtls By Harry Fairhead…
ALT Linux – sisyphus – mbedtls-3.4.0-alt1.1
Build time: Mar 30, 2023, 11:28 AM in the task #317761 Description: mbed TLS is a light-weight open source cryptographic and SSL/TLS library written in C. mbed TLS makes it easy for developers to include cryptographic and SSL/TLS capabilities in their (embedded) applications with as little hassle as possible. List of…
I need openssl-1.1. After system upgrade I have v3 and pacman -S openssl-1.1 finds conflicts – AUR
I just did a system upgrade and now I have openssl 3.0.8-1. I tried to upgrade my rstudio-desktop-bin but it says it needs openssl-1.1. I tried to install openssl-1.1 but it has conflicts. Does anyone know how to get rstudio-desktop-bin to work with the current stable branch? Trying rstudio-desktop-bin install:…
Undefined reference to ESP-IDF component – Development Platforms
Greetings!I’m trying to reproduce esp-idf example storage/spiffsgen. Getting error: c:/users/kossn/.platformio/packages/toolchain-xtensa-esp32/bin/../lib/gcc/xtensa-esp32-elf/11.2.0/../../../../xtensa-esp32-elf/bin/ld.exe: .pio\build\esp32dev\src\spiffsgen_example_main.o:(.literal.compute_alice_txt_md5+0x14): undefined reference to `mbedtls_md5_init’ c:/users/kossn/.platformio/packages/toolchain-xtensa-esp32/bin/../lib/gcc/xtensa-esp32-elf/11.2.0/../../../../xtensa-esp32-elf/bin/ld.exe: .pio\build\esp32dev\src\spiffsgen_example_main.o:(.literal.compute_alice_txt_md5+0x18): undefined reference to `mbedtls_md5_starts’ c:/users/kossn/.platformio/packages/toolchain-xtensa-esp32/bin/../lib/gcc/xtensa-esp32-elf/11.2.0/../../../../xtensa-esp32-elf/bin/ld.exe: .pio\build\esp32dev\src\spiffsgen_example_main.o:(.literal.compute_alice_txt_md5+0x1c): undefined reference to `mbedtls_md5_update’ c:/users/kossn/.platformio/packages/toolchain-xtensa-esp32/bin/../lib/gcc/xtensa-esp32-elf/11.2.0/../../../../xtensa-esp32-elf/bin/ld.exe: .pio\build\esp32dev\src\spiffsgen_example_main.o:(.literal.compute_alice_txt_md5+0x20): undefined reference to `mbedtls_md5_finish’ c:/users/kossn/.platformio/packages/toolchain-xtensa-esp32/bin/../lib/gcc/xtensa-esp32-elf/11.2.0/../../../../xtensa-esp32-elf/bin/ld.exe: .pio\build\esp32dev\src\spiffsgen_example_main.o: in function `compute_alice_txt_md5′: D:\ESP32\spiffsgen/src/spiffsgen_example_main.c:45: undefined reference to `mbedtls_md5_init’ c:/users/kossn/.platformio/packages/toolchain-xtensa-esp32/bin/../lib/gcc/xtensa-esp32-elf/11.2.0/../../../../xtensa-esp32-elf/bin/ld.exe: D:\ESP32\spiffsgen/src/spiffsgen_example_main.c:46: undefined reference to `mbedtls_md5_starts’ c:/users/kossn/.platformio/packages/toolchain-xtensa-esp32/bin/../lib/gcc/xtensa-esp32-elf/11.2.0/../../../../xtensa-esp32-elf/bin/ld.exe:…
mbedtls 3.4.0 – Download, Browsing & More
mbedtls 3.4.0 – Download, Browsing & More | Fossies Archive “Fossies” – the Fresh Open Source Software Archive Contents of mbedtls-3.4.0.tar.gz (27 Mar 19:05, 4892512 Bytes) About: Mbed TLS is a “portable, easy to use, readable and flexible” SSL library that implements cryptographic primitives, X.509 certificate manipulation and the SSL/TLS…
“User logged in:” but not actually logged in – JupyterHub
azega March 27, 2023, 8:44am 1 Typing jupyterhub in a terminal on a fresh jupyterhub install through anaconda on a red hat 8.7 server – I get a login screen on :8000 port, all is well. When I type the username and password (I know it’s correct, because I am…
docker compose – Can’t login to my server jupyterhub via http – Stack Overflow
I’m trying to set up a jupyterhub on my server and access it via an external network. I’m new on it so I’m using this repo as a starting point. I changed jupyterhub_config.py to use a Dummy authenticator. The complete file looks like this: import os c = get_config() #…
Invalid Connection
Invalid Connection This Connection is Invalid. SSL certificate expired. A secure connection to eprints.ncl.ac.uk cannot be established. When you try to connect securely, sites will present trusted identification to prove that you are going to the right place. However, this site’s identity can’t be verified. Site eprints.ncl.ac.uk Certificate CN eprints.ncl.ac.uk…
error in downloading of some accesions with fastq-dump
error in downloading of some accesions with fastq-dump 2 Hi all, When I’m running fastq-dump with some accessions everything works fine, for example: fastq-dump –split-files SRR10345445 Results are ok when I am running the program with other access codes I get an error, for example: fastq-dump –split-files SRR5631167 connection failed…
ACME fails mbedTLS SSL – fatal alert message – Installing and Using OpenWrt
pmisch March 15, 2023, 10:04pm #1 Hi, I just installed 22.03.3 on an RT-AX53U (Asus). I’m trying to fetch letsencrypt cert via dns challenge.It seems this is failing due to OpenWrt not recognizing a valid Letscencrypt certificate. When I manually curl against the API URL of the powerdns server it…