Tag: TSS

Single-cell analyses define a continuum of cell state and composition changes in the malignant transformation of polyps to colorectal cancer

Mapping molecular changes across malignant transformation We generated single-cell data for 81 samples collected from eight FAP and seven non-FAP donors (Fig. 1a and Supplementary Tables 1 and 2). For each tissue, we performed matched scATAC-seq and snRNA-seq (10x Genomics). We obtained high-quality single-cell chromatin accessibility profiles for 447,829 cells…

Continue Reading Single-cell analyses define a continuum of cell state and composition changes in the malignant transformation of polyps to colorectal cancer

Bio-informatic analysis of CRISPR protospacer adjacent motifs (PAMs) in T4 genome | BMC Genomic Data

The clustered regularly interspaced short palindromic repeats-Cas (CRISPR-Cas) defensive system is an acquired mechanism in prokaryotes which is analogous to RNAi in eukaryotes [1]. The CRISPR machinery is a complex immune strategy that is continually evolving in the bacterial genome to accommodate the rapid changes in the nucleic acids of…

Continue Reading Bio-informatic analysis of CRISPR protospacer adjacent motifs (PAMs) in T4 genome | BMC Genomic Data

Transcription Start Site

Transcription Start Site 2 What are the best databases to check out the transcription start sites of specific genes in human genome? TSS • 130 views wget -q -O – “http://hgdownload.cse.ucsc.edu/goldenPath/hg19/database/wgEncodeGencodeBasicV19.txt.gz” | gunzip -c | awk ‘(int($7)< int($8)) {if($4==”+”) {printf(“%s\t%d\t%d\t%s\t%s\n”,$3,$7,int($7)+1,$2,$4);}else {printf(“%s\t%d\t%d\t%s\t%s\n”,$3,int($8)-3,$8,$2,$4);}}’ chr1 69090 69091 ENST00000335137.3 + chr1 139306 139309 ENST00000423372.3…

Continue Reading Transcription Start Site

peroxisomal multifunctional enzyme type 2-like, maker-scaffold366_size194251-snap-gene-0.19 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of peroxisomal multifunctional enzyme type 2-like vs. L. salmonis genes Match: EMLSAG00000010112 (supercontig:LSalAtl2s:LSalAtl2s668:190059:194758:1 gene:EMLSAG00000010112 transcript:EMLSAT00000010112 description:”augustus_masked-LSalAtl2s668-processed-gene-1.1″) HSP 1 Score: 102.064 bits (253), Expect = 2.195e-25Identity = 65/191 (34.03%), Postives = 101/191 (52.88%), Query Frame = 0 Query: 134 GKVALVTGAGGGLGKAYALLLASRGASVVVNDLGGSRTGEGQSSKAADEVVNEIRQKGGKAV—–GNYDSVEDGEAVIKTALDNFGRIDIVINNAGILRDRSIGRTSDSDWDLVQKVHLRGAFQVIRAAWPHMKKQKYGRIINTSSVAGIFGNFGQSNYSSAKAGLIGLTSTLAIEGERSGIQANVIVP 319 GKVAL+TGA G+G++ A+L A…

Continue Reading peroxisomal multifunctional enzyme type 2-like, maker-scaffold366_size194251-snap-gene-0.19 (gene) Tigriopus kingsejongensis

A mammalian methylation array for profiling methylation levels at conserved sequences

Designing the mammalian methylation array The CMAPS algorithm is designed to select a set of Illumina Infinium array probes such that for a target set of species many probes are expected to work in each species (see “Methods” section). Array probes are sequences of length 50 bp flanking a target CpG…

Continue Reading A mammalian methylation array for profiling methylation levels at conserved sequences

Novel technologies in cfDNA analysis and potential utility in clinic

. 2021 Dec 31;33(6):708-718. doi: 10.21147/j.issn.1000-9604.2021.06.07. Affiliations Expand Affiliations 1 Department of Basic Medical Sciences, School of Medicine, Tsinghua University, Beijing 100084, China. 2 Department of General Surgery, Peking Union Medical College Hospital, Chinese Academy of Medical Science & Peking Union Medical College, Beijing 100730, China. 3 Department of Medical…

Continue Reading Novel technologies in cfDNA analysis and potential utility in clinic

can not upload GTF file to UCSC genomebrowser

We are unable to reproduce the error you are seeing and we also recentlyexperienced temporary issues with our site. Please let us know if youare still having this problem. Post by Gang WeiDear manager of UCSC Genome Browser,Glad to write to you. I’m now using UCSC genome browser to check…

Continue Reading can not upload GTF file to UCSC genomebrowser

RNA polymerase II trapped on a molecular treadmill: Structural basis of persistent transcriptional arrest by a minor groove DNA binder

Significance Hairpin pyrrole-imidazole (Py-Im) polyamides can be programmed to bind a broad repertoire of DNA sequences. Py-Im small molecules can be used to target cancer-specific coding regions and block transcription elongation. This transcription blockage by Py-Im cannot be rescued by transcription elongation factors, such as TFIIS. The mechanism by which…

Continue Reading RNA polymerase II trapped on a molecular treadmill: Structural basis of persistent transcriptional arrest by a minor groove DNA binder

Pan-AMPK activator O304 prevents gene expression changes and remobilisation of histone marks in islets of diet-induced obese mice

O304 treatment prevents islet gene expression signature changes induced by HFD We have previously demonstrated that the AMPK activator O304 improves blood glucose homeostasis in both human T2D subjects as well as in high-fat diet induced obese and diabetic mouse models. In the present study, we have now analysed the…

Continue Reading Pan-AMPK activator O304 prevents gene expression changes and remobilisation of histone marks in islets of diet-induced obese mice

HIRA complex presets transcriptional potential through coordinating depositions of the histone variants H3.3 and H2A.Z on the poised genes in mESCs

doi: 10.1093/nar/gkab1221. Online ahead of print. Yang Yang  1   2 , Liwei Zhang  3 , Chaoyang Xiong  2 , Jun Chen  2   4   5 , Li Wang  6 , Zengqi Wen  2   5 , Juan Yu  2 , Ping Chen  4 , Yanhui Xu  6 , Jingji Jin  1   7   8 , Yong Cai …

Continue Reading HIRA complex presets transcriptional potential through coordinating depositions of the histone variants H3.3 and H2A.Z on the poised genes in mESCs

Homer finds same peak multiple times

I am using Homer to identify peaks in RNA-seq data and then determine differential expression by counting reads per peak. Homer has a lovely package that does just this: getDifferentialPeaksReplicates.pl. The issue is that for some reason Homer returns the same peak multiple times in its final output (Bonus question:…

Continue Reading Homer finds same peak multiple times

RPKM on TSS using DiffBind

RPKM on TSS using DiffBind 1 Hi everyone, I want to extrapolate RPKM value from Diffbind. Investigated regions are TSS (± 2.5kb) but around 3500 TSS are “lost” because merged. I have read that in the new version of DiffBind is possible to use dbObj_region$config$mergeOverlap with negative value to avoid…

Continue Reading RPKM on TSS using DiffBind

Determining the microbial and chemical contamination in Ecuador’s main rivers

Bacterial contamination in urban areas of the main Ecuadorian rivers All rivers showed E. coli levels above standard concentrations for bathing-water recommended by the USA, European and Brazilian guidelines (Fig. 1), in concordance with other studies in Latin America, such as Colombia34, Mexico4, and Perú35. Most of the rivers in this…

Continue Reading Determining the microbial and chemical contamination in Ecuador’s main rivers

Bedfile format deeptools

Bedfile format deeptools 1 Hello everyone, Using deeptools I am trying to plot the enrichment in Genebody and TSS for this we have to give one BED file region of interest in computeMatrix. I am bit confused about the format based on a thread in biostar TSS metaprofile using Deeptoolsbased…

Continue Reading Bedfile format deeptools

Senior Bioinformatics Support Scientist | Illumina

Why Us    Illumina are growing at pace, and we are looking for the best customer focused Bioinformatics Support Scientist to join our mission, to improve human health by unlocking the power of the genome. By joining Illumina as a Bioinformatics Support Scientist in our EMEA Head Office, Cambridge UK, you will help support…

Continue Reading Senior Bioinformatics Support Scientist | Illumina

Frontiers | DNA Methylation and RNA-Sequencing Analysis Show Epigenetic Function During Grain Filling in Foxtail Millet (Setaria italica L.)

Introduction Gene expression is not only controlled by DNA sequences but also by epigenetic marks in eukaryotes. DNA methylation as one of the important epigenetic modifications has been demonstrated as closely related to gene expression in biological processes, such as transcriptional activity, developmental regulation, and environmental responses (Maunakea et al.,…

Continue Reading Frontiers | DNA Methylation and RNA-Sequencing Analysis Show Epigenetic Function During Grain Filling in Foxtail Millet (Setaria italica L.)

Multiform antimicrobial resistance from a metabolic mutation

Abstract A critical challenge for microbiology and medicine is how to cure infections by bacteria that survive antibiotic treatment by persistence or tolerance. Seeking mechanisms behind such high survival, we developed a forward-genetic method for efficient isolation of high-survival mutants in any culturable bacterial species. We found that perturbation of…

Continue Reading Multiform antimicrobial resistance from a metabolic mutation

Extracting variations in the gene regions and from 100 bp of gene boundary from multiple VCF files

Extracting variations in the gene regions and from 100 bp of gene boundary from multiple VCF files 0 Hi, I sincerely hope that I am not repeating an already answered question. I couldn’t find the answer to my exact problem. I have three VCF files derived using bcftools (isec). Those…

Continue Reading Extracting variations in the gene regions and from 100 bp of gene boundary from multiple VCF files

computematrix how to set certain TSS

computematrix how to set certain TSS 1 how to set certain TSS deeptools computematrix, I want to visualize the certain gene’s TSS up/downstream instead of whole gene,but how can I do it ? thanks. deeptools • 34 views You probably want the reference-point mode as described here. You will also…

Continue Reading computematrix how to set certain TSS