Tag: VG

hypothetical protein DAPPUDRAFT_213302, maker-scaffold2255_size18018-snap-gene-0.6 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of hypothetical protein DAPPUDRAFT_213302 vs. L. salmonis genes Match: EMLSAG00000000401 (supercontig:LSalAtl2s:LSalAtl2s1063:86108:87342:-1 gene:EMLSAG00000000401 transcript:EMLSAT00000000401 description:”maker-LSalAtl2s1063-snap-gene-0.46″) HSP 1 Score: 149.443 bits (376), Expect = 4.121e-44Identity = 91/196 (46.43%), Postives = 119/196 (60.71%), Query Frame = 0 Query: 14 MDKITDLQVEPLT–NSRFVKPLRLRFKQDGKVKVWDLIQCHASVAVVIFNQTTQKFVFVRQFRPAVYFSALRRAQGDVEPGTQFKGDEIDPKVGITLELCAGIVD-KSKSLIEIAHEEILEETGYDVPMNLIEEIQTFPVGVGVGGENMTLFCAEVTEAMRKGPGGGLAEEGEMIDVIEMGVEETRTLMRAKSVT 206 MDK+ VEPL +SRFV P R+ ++Q+G…

Continue Reading hypothetical protein DAPPUDRAFT_213302, maker-scaffold2255_size18018-snap-gene-0.6 (gene) Tigriopus kingsejongensis

Merging .gam files

Merging .gam files 1 Can anyone point me towards a method to merge gam files that are created by using ‘ vg map ‘ to map illumina reads to my genome graph? I would like to be able to map all of the sequencing runs separately and then merge the…

Continue Reading Merging .gam files

Creating a variation graph for Giraffe alignment from assemblies

Creating a variation graph for Giraffe alignment from assemblies 0 I have a collection of ~100 4.5 megabase haploid assemblies that I would like to map to using giraffe. However, I am not completely clear on what the best practices are to construct the graph starting from the assemblies. I…

Continue Reading Creating a variation graph for Giraffe alignment from assemblies