Categories
Tag: VP
AI Remote Jobs 2024: 10 Opportunities in India
Analytics Insight has listed top 10 AI remote job opportunities hiring in India Sriram Raghavan, IBM Research AI VP, highlighted IBM’s collaboration with NASA for an advanced AI model during recent AI events in India. Discussing AI’s role in preventing Black Swan events, he showcased the AI Alliance launch with…
Frontiers Publishing Partnerships | Construction of recombinant adenovirus-5 vector to prevent replication-competent adenovirus occurrence
Introduction In recent years, recombinant adenoviral vectors have been used in different fields of biomedical sciences such as in vitro and in vivo gene transfer, vaccine development, and gene therapy (Russell, 2000; Mitani and Kubo, 2002). Multiple features of recombinant adenoviral vectors such as high packaging capacity for transgene insertion,…
Programmable Genomic Integration Company Raises Over $200 Million
Tome Biosciences – a programmable genomic integration company – recently announced it has launched to usher in a new era of genomic medicines based on programmable genomic integration (PGI). PGI enables the insertion of any DNA sequence of any size into any programmed genomic location. And the company has raised…
Illumina to Divest of Grail after Appeals Court Defeat
Battered by more than three years of opposition from authorities in the United States and Europe—most recently an unfavorable federal appeals court decision on Friday—Illumina said it will divest itself of Grail, the cancer blood test developer it bought for $7.1 billion. Illumina said it will carry out the divestiture…
hypothetical protein LOTGIDRAFT_99224 partial, maker-scaffold1322_size48131-snap-gene-0.13 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of hypothetical protein LOTGIDRAFT_99224 partial vs. L. salmonis genes Match: EMLSAG00000006769 (supercontig:LSalAtl2s:LSalAtl2s379:476161:478870:-1 gene:EMLSAG00000006769 transcript:EMLSAT00000006769 description:”maker-LSalAtl2s379-augustus-gene-4.10″) HSP 1 Score: 59.6918 bits (143), Expect = 4.225e-12Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 0 Query: 22 AANARERTRMRVLSKAFGRLKLTLPWVPPDTKLSKLDTLRLATSYISHLQRLLSDEE 78 +N +ER R + ++…
Verrica Pharmaceuticals Announces Positive Results from Phase 3 Trial of TO-208 for Molluscum Treatment in Japan
WEST CHESTER, PA — Verrica Pharmaceuticals Inc. (Nasdaq: VRCA), a leading dermatology therapeutics provider, has shared promising top-line results from the Phase 3 trial of TO-208 for molluscum contagiosum (“molluscum”) treatment in Japan. The trial was conducted by Torii Pharmaceutical Co., Ltd., Verrica’s development and commercialization partner. The double-blind, randomized,…
Verrica stock rallies 55% amid positive Phase 3 results for skin drug (NASDAQ:VRCA)
phive2015 Verrica Pharmaceuticals (NASDAQ:VRCA) stock soared 55% Friday morning after development partner Torii Pharmaceutical reported positive topline results from a confirmatory Phase 3 study for its drug TO-208, also known as Ycanth, in the treatment of molluscum, a contagious skin infection. The biotech company said the study, which was conducted…
Torii Pharmaceutical Co., Ltd. Announces Positive Top-Line Results from a Confirmatory Phase 3 Trial of TO-208 for the Treatment of Molluscum Contagiosum in Japan -December 15, 2023 at 06:00 am EST
Verrica Pharmaceuticals Inc. announced that its development and commercialization partner, Torii Pharmaceutical Co., Ltd. reported positive top-line results from its Phase 3 trial of TO-208 (referred to as VP-102 and marketed as YCANTH(TM) in the U.S.) for the treatment of Molluscum Contagiosum (“molluscum”) in Japan. The Phase 3 trial was…
Verrica Pharma: Torii Reports Positive Top-line Results From Confirmatory Phase 3 Trial Of TO-208
(RTTNews) – Verrica Pharmaceuticals Inc. (VRCA) said its partner, Torii Pharmaceutical Co., reported positive top-line results from Phase 3 trial of TO-208 for the treatment of Molluscum Contagiosum in Japan. The results showed that the proportion of subjects achieving complete clearance of all treatable molluscum lesions at the completion of…
Verrica Pharmaceuticals Shares Rise After Partner Reports Trial Results
By Will Feuer Shares of Verrica Pharmaceuticals climbed after its development and commercialization partner, Torii Pharmaceutical, reported positive top-line results from its Phase 3 trial of its potential treatment for molluscum contagiosum in Japan. The stock rose about 8% to $4.06 in premarket trading. Shares were already up about 37%…
Colt VP: 8-ways to secure enterprise-wide APIs
APIs are everywhere. In the modern age of web, cloud, AI and interconnected containerised componentry, enterprise software is typified by its use of Application Programming Interfaces (APIs). Written to a defined syntax, structure and shape, APIs are often referred to as the ‘glue’ that bonds one of more applications, smaller…
Torii Shares Positive Data From Japan Trial of TO-208 for Molluscum Contagiosum
Verrica Pharmaceuticals Inc. and its partner, Torii Pharmaceutical Co., Ltd., today shared positive top-line results from the phase 3 trial of TO-208, also known as VP-102, and marketed as YCANTH in the US, for the treatment of molluscum contagiosum in Japan. The confirmatory phase 3 trial, conducted in Japan, utilized…
Genomic Predictors Associated With Exceptional Response to Systemic Therapy in Advanced Pancreatic Cancer
ABSTRACT Introduction: Exceptional response to therapy is rare in patients with advanced pancreatic cancer. This study explored potential genomic differences between typical and exceptional responses that could confer more favorable biology. Methods: We included exceptional responders and controls with advanced pancreatic cancer from Cleveland Clinic from April 2013 to August…
Why Is Verrica Pharmaceuticals (VRCA) Stock Up 40% Today?
Source: Gorodenkoff / Shutterstock.com Shares of Verrica Pharmaceuticals (NASDAQ:VRCA) skyrocketed on Friday thanks to positive late-stage clinical trial results. Specifically, Verrica — along with its development and commercialization partner Torii Pharmaceutical — reported positive top-line results from its Phase 3 trial of TO-208 for the treatment of molluscum contagiosum in…
Verrica Pharmaceuticals’ Development and Commercialization
WEST CHESTER, Pa., Dec. 15, 2023 (GLOBE NEWSWIRE) — Verrica Pharmaceuticals Inc. (“Verrica” or “the Company”) (Nasdaq: VRCA), a dermatology therapeutics company developing medications for skin diseases requiring medical interventions, today announced that its development and commercialization partner, Torii Pharmaceutical Co., Ltd. (“Torii”), reported positive top-line results from its Phase…
Torii Pharmaceutical : Top-line Results of Phase 3 Clinical Study of TO-208 for the Treatment of Molluscum Contagiosum in Japan -December 15, 2023 at 06:28 am EST
Official TORII PHARMACEUTICAL CO., LTD. press release Tokyo, December 15, 2023 FOR IMMEDIATE RELEASE Top-line Results of Phase 3 Clinical Study of TO-208 for the Treatment of Molluscum Contagiosum in Japan Torii Pharmaceutical Co., Ltd. (Torii) (TSE:4551) announces the top-line results of Phase 3 comparative study for TO-208, conducted in…
Torii Reports Positive Top-line Results From Confirmatory Phase 3 Trial Of TO-208
Verrica Pharmaceuticals Inc. (VRCA) said its partner, Torii Pharmaceutical Co., reported positive top-line results from Phase 3 trial of TO-208 for the treatment of Molluscum Contagiosum in Japan. The results showed that the proportion of subjects achieving complete clearance of all treatable molluscum lesions at the completion of the confirmatory…
Google introduces MedLM designed for health industry use cases
Google announced the release of MedLM, two foundational models built off Med-PaLM 2, designed to answer medical questions, generate insights from unstructured data and summarize medical information. The tech giant said that through piloting its LLMs with healthcare organizations, it has learned the most effective AI models are designed to…
Google’s New AI, Gemini, Beats ChatGPT In 30 Of 32 Test Categories
Better performance than ChatGPT? © 2023 Bloomberg Finance LP Google has released a new Pro model of its latest AI, Gemini, and company sources say it has outperformed GPT-3.5 (the free version of ChatGPT) in widespread testing. According to performance reports, Gemini Ultra exceeds current state-of-the-art results on 30 of…
Tome Biosciences Launches with Over $200 Million in Funding to Advance Programmable Genomic Integration Platform
Tome Biosciences Launches with Over $200 Million in Funding to Advance Programmable Genomic Integration Platform Technology, in-licensed from the Massachusetts Institute of Technology (MIT), capable of inserting DNA sequences of any size into any programmed genomic location Potential to create curative cell and integrative gene therapies Backed by leading biotech…
Unacast Powers Up Location Analytics with Google Cloud’s Generative AI Platform
NEW YORK, Dec. 12, 2023 /PRNewswire/ — Today, Unacast announced a partnership with Google Cloud that combines the cloud company’s generative AI technology with best-in-class location data. This collaboration involves Unacast leveraging Google Cloud’s Vertex AI platform along with its own location analytics platform, Unacast Insights. This combination powers Unacast’s gen…
Unacast Powers Up Location Analytics with Google Cloud’s Generative AI Platform
Today, Unacast announced a partnership with Google Cloud that combines the cloud company’s generative AI technology with best-in-class location data. This collaboration involves Unacast leveraging Google Cloud’s Vertex AI platform along with its own location analytics platform, Unacast Insights. This combination powers Unacast’s gen AI chatbot, Una, who interacts with…
2024 Toyota Highlander: Pricing and details for Canada | Car News
• 2024 Toyota Highlander: here are the changes, and prices for the new year. Details for the 2024 Toyota Highlander have been released, with each trim getting a few more bits of equipment as standard for the coming year, and the Highlander Hybrid getting its own Nightshade Edition. Explains Toyota…
Takara Bio USA Wins EU Opposition Hearing, Revoking Jumpcode Genomics’ NGS Library Enrichment Patent
Article content SAN JOSE, Calif. — Takara Bio USA, Inc. today announced that it has once again prevailed in its second patent dispute with Jumpcode Genomics, Inc. The latest result concerns Takara Bio USA’s challenge to the validity of Jumpcode’s granted European patent EP3102722. Following a hearing before the Opposition…
IJMS | Free Full-Text | The Link of mRNA and rRNA Transcription by PUF60/FIR through TFIIH/P62 as a Novel Therapeutic Target for Cancer
This study demonstrated the novel coactivation mechanism of mRNA and rRNA underlying the role of FIR and its splicing variant, FIRΔexon2. Because FIR is immunoprecipitated with P89 and P62 of TFIIH [7], FIR potentially affects RNAPII-mediated transcription via TFIIH. As expected, FIR affected the mRNA expression of various cancer-related genes…
DNA Sequencing Electrophoresis System Market Analysis: Its CAGR, Market Segmentation and Global Industry Overview | by Favor Look Seal | Dec, 2023
DNA Sequencing Electrophoresis System Market Trends, Growth Opportunities, and Forecast Scenarios {Provide Informative Summary on DNA Sequencing Electrophoresis System market research reports specific to market conditions. Also, give a Brief overview of the report’s main findings and recommendations. Write about the latest trends followed by DNA Sequencing Electrophoresis System market…
Fapon VP/SVP/CSO/CTO – Nanopore sequencing, LUNAR BIOSCIENCES
Fapon is an industry-leading IVD platform organization that offers an unmatched product and service combination of innovative biomarkers and bioactive raw materials, and one-stop solutions of Open Instrument Systems and Reagents, with our mission to enable earlier disease identification and more convenient, accurate, and affordable diagnosis. Nowadays, we have well…
Google Announces New AI Model: Gemini
Google’s Gemini, the largest scientific and research undertaking in the company’s history, stands as the culmination of extensive collaborative efforts across diverse Google teams, including Google DeepMind and Google Research. According to the company, Gemini’s state-of-the-art capabilities will significantly enhance the way developers and companies build and scale with AI. …
Tesla Plans to Resume the Shanghai Phase 3 Factory Project, Supplying Energy Storage Products Domestically
Exclusive information obtained by LatePost reveals that Tesla is planning to resume the construction of its third phase automobile factory in Shanghai. In April this year, Tesla announced plans to build a new energy storage battery factory with an annual production capacity of 40 GWh in Shanghai, which is expected…
Bioinformatics Analyst – Charlottesville, Virginia, United States
Who would you like to share this job with? 11101fb9 Categories 2c89bb9c Categories 3c530996 Academic Advising / SupportAdministrationAdministrative / ClericalAdministrative ServicesAdvancementAgriculture / Life ScienceAgriculture and Animal HealthAlumni RelationsApplied Sciences and Natural ResourcesArchitecture / Construction / PlanningArchitecture / EngineeringAudit and FinanceBusiness / Accounting / FinanceCommunications / Public Relations / MarketingData…
Luteibacter jiangsuensis blood stream infection: a first case report | BMC Infectious Diseases
Gram staining, culture conditions, and antimicrobial susceptibility testing Gram staining was performed using the neo-B&M Wako (Fujifilm Wako Chemicals, Osaka, Japan). The L. jiangsuensis isolate was grown at 37 ℃ for 24 h on Sheep Blood Agar (T) (Nippon Becton Dickinson, Tokyo, Japan) and Drigalski Lactose Agar (Eiken Chemical, Tokyo, Japan)….
Versatex introduces first 16-foot cellular PVC lap siding
Versatex, an establoshed name in innovative cellular PVC building products, has just introduced XCEED Lap Siding, an advanced cellular PVC cladding for residential construction and remodeling. “When I say XCEED offers contractors new color trends, an improved installation experience and greater dimensional stability,” said Versatex president and founder John Pace,…
Pfizer and Valneva Complete Recruitment for Phase 3 VALOR
Pfizer and Valneva Complete Recruitment for Phase 3 VALOR Trial for Lyme Disease Vaccine Candidate, VLA15 9,437* participants enrolled at sites across the U.S., Europe and Canada in areas where Lyme disease is endemic Trial conclusion expected by year-end 2025 Pfizer aims to submit regulatory filings in the U.S. and…
Pfizer and Valneva Complete Recruitment for Phase 3 VALOR Trial for Lyme Disease Vaccine Candidate, VLA15
9,437* participants enrolled at sites across the U.S., Europe and Canada in areas where Lyme disease is endemic Trial conclusion expected by year-end 2025 Pfizer aims to submit regulatory filings in the U.S. and Europe in 2026 New York, NY, and Saint-Herblain (France), December 4, 2023 – Pfizer Inc. (NYSE:…
Google Cloud Global VP On ‘Massive’ 2024 GenAI Incentives For Partners And Why AI Tech Bests AWS And Microsoft
Cloud News Mark Haranas December 04, 2023, 11:00 AM EST Google Cloud’s partner ecosystem leader Kevin Ichhpurani explains new GenAI channel incentives ahead for partners in 2024, as well as why AI partners should pick Google over AWS and Microsoft. Partners looking…
Direct Detection of Fluoroquinolone Resistance in Sputum Samples from Tuberculosis Patients by High Resolution Melt Curve Analysis
WHO (2022) Global Tuberculosis Report. WHO (2022) WHO consolidated guidelines on tuberculosis, Module 4: Treatment- Drug-resistant tuberculosis treatment: 2022 update. WHO (2020) Meeting report of the WHO expert consultation on the definition of extensively drug-resistant tuberculosis. Jabeen K, Shakoor S, Hasan R (2015) Fluoroquinolone-resistant tuberculosis: implications in settings with weak…
Google AI Generated Media Protecting Users From Risks Misinformation
At a time when misinformation, especially that originating from artificial intelligence (AI) and deepfakes is on the rise, Google India on Wednesday highlighted how it is protecting users from the risks of AI generated media in the country. The tech giant mentioned “there is no silver bullet to combat deep…
Release Testing Of AAV Gene Therapies For Clinical Trials
By Mark Haydock, biologics CMC consultant, Agile Biologics Consulting LLC Adeno-associated virus (AAV) gene therapies that are designed to deliver a therapeutic transgene to patients are complex products that can be challenging to manufacture. Because of their complexity, a variety of analytical methods are required to ensure that these viral…
Symphony Integrates Google’s AI for Enhanced Voice Analytics in Finance Sector
Symphony, a prominent market infrastructure and technology firm, is joining forces with Google to enhance voice analytics capabilities for banks and investment firms. This strategic collaboration comes in response to heightened regulatory scrutiny on communications compliance within the financial industry. The US Securities and Exchange Commission (SEC) has already imposed…
Symphony Partners with Google to Elevate Voice Analytics for Financial Firms Amid Regulatory Scrutiny
Symphony, a markets infrastructure and technology firm, has joined forces with Google to bolster its voice analytics offering for banks and investment firms. This collaboration aims to address heightened regulatory scrutiny surrounding communications compliance within the financial sector.The U.S. Securities and Exchange Commission’s imposition of over $2 billion in fines,…
Symphony Joins Forces with Google for Advanced Voice Analytics in Finance
As regulatory scrutiny on financial communications intensifies, Symphony is taking a proactive leap forward by partnering with Google to enhance its voice analytics capabilities. This powerful collaboration is aimed at helping banks and investment firms bolster compliance efforts in an era where non-compliant communications could result in hefty fines. With…
Google, Symphony unveil AI JV to help banks manage voice calls compliance risk
The logo of Google LLC is seen at the Google Store Chelsea in New York City, U.S., January 20, 2023. REUTERS/Shannon Stapleton/File Photo Acquire Licensing Rights LONDON, Nov 28 (Reuters) – Symphony, the markets infrastructure and tech firm, is teaming up with Google (GOOGL.O) to ramp up its voice analytics…
Genome Sequencing in Field Crops: Unlocking Agricultural Potential
Genome Sequencing in Field Crops: Unlocking Agricultural Potential Rishabh Gupta Department of Genetics and Plant Breeding, Acharya Narendra Deva University of Agriculture and Technology, Kumarganj, Ayodhya, Uttar Pradesh (224229), India. Anuj Verma Department of Genetics and Plant Breeding, Acharya Narendra Deva University of Agriculture and Technology, Kumarganj, Ayodhya, Uttar Pradesh…
King’s College, Bit.bio Partner for Advanced Brain Cell Models
bit.bio, the company coding human cells for novel cures, and the Institute of Psychiatry, Psychology & Neuroscience today announce a collaboration to build multi-cell models of the human brain using bit.bio’s ioCells™️. Professor Deepak Srivastava and Dr Anthony Vernon Professor Deepak Srivastava and Dr Anthony Vernon will create different bi-…
Curium Completes Patient Enrollment of Phase 3 ECLIPSE Trial Ahead of Schedule
This section is Partnership Content supplied The content in this section is supplied by GlobeNewswire for the purposes of distributing press releases on behalf of its clients. Postmedia has not reviewed the content. by GlobeNewswire Breadcrumb Trail Links GlobeNewswire Author of the article: Published Nov 23, 2023 • 2 minute…
BioVie: Cautiously Optimistic Ahead Of Phase 3 Alzheimer’s Data Unblinding (NASDAQ:BIVI)
BlackJack3D Intro Neurodegenerative disease-focused BioVie (NASDAQ:BIVI) recently presented a set of blinded data which, if taken at face value, suggest that its lead asset NE3107 may have robust (and potentially unprecedented) cognitive and biomarker efficacy in Alzheimer’s disease. On October 25th, the company presented blinded data from its Phase 3…
Phase 3 Study for AbbVie’s Ubrelvy Reports Promising Results
Medication focuses on the acute treatment of migraines. AbbVie announced results published in The Lancet evaluating the efficacy, safety, and tolerability of Ubrelvy (ubrogepant) 100 mg for the acute treatment of migraine when administered during the prodrome of a migraine attack. According to a Phase 3 prodrome study, results indicated…
Want that promotion? Return to the office, says Amazon
Amazon employees who fail to comply with the company’s return to office policies could risk missing out on promotions or career advancement, according to reports. Posts on Amazon’s internal employee website and viewed by CNBC suggest that employees who fail to return to the office at least three days a…
Datadog Releases 2023 State of Cloud Security Report
Report finds that long-lived credentials remain a common cause for cloud security breaches NEW YORK, Nov. 15, 2023 /PRNewswire/ — Datadog, Inc. (NASDAQ: DDOG), the monitoring and security platform for cloud applications, today released its new report, The State of Cloud Security 2023. Datadog analyzed security posture data from thousands of organizations…
IMUNON’s VP of R&D to Present at the Vaccines Summit-2023
Imunon, Inc. Dr. Jean Boyer to highlight updated data showing the advantages of IMUNON’s PlaCCine modality and its applicability to multiple pathogens LAWRENCEVILLE, N.J., Nov. 14, 2023 (GLOBE NEWSWIRE) — IMUNON, Inc. (NASDAQ: IMNN), a clinical-stage biotechnology company focused on harnessing the power of the immune system against cancer and…
Pendo and Google Cloud Partner to Transform Product Management with Generative AI Capabilities and Training
Pendo will leverage Vertex AI throughout its application experience platform to power exponentially better digital experiences for customers RALEIGH, N.C. and SUNNYVALE, Calif. and LISBON, Portugal , Nov. 14, 2023 /PRNewswire/ — Pendo , the leader in application experience management, today announced an expanded partnership with Google Cloud to leverage…
New VP&S Faculty | Columbia University Irving Medical Center
The VP&S Office of Faculty Affairs has provided this list of full-time faculty who joined the medical school in August 2023. Amit Batta, DO, Psychiatry Jehanne Belange, MD, Emergency Medicine Tom D. Ben Dov, MD, Otolaryngology/Head & Neck Surgery: Ben Dov has joined the Division of Pediatric Otolaryngology. His research…
Valneva Reports Positive Pivotal Phase 3 Immunogenicity Data in Adolescents for its Single-Shot Chikungunya Vaccine Candidate
Saint-Herblain (France), November 13, 2023 – Valneva SE (Nasdaq: VALN; Euronext Paris: VLA), a specialty vaccine company, today reported positive pivotal Phase 3 immunogenicity data in adolescents for its single-dose chikungunya virus (CHIKV) vaccine candidate VLA1553. These results complement the initial Phase 3 safety data the Company reported for the…
Valneva Reports Positive Pivotal Phase 3 Immunogenicity
Saint-Herblain (France), November 13, 2023 – Valneva SE (Nasdaq: VALN; Euronext Paris: VLA), a specialty vaccine company, today reported positive pivotal Phase 3 immunogenicity data in adolescents for its single-dose chikungunya virus (CHIKV) vaccine candidate VLA1553. These results complement the initial Phase 3 safety data the Company reported for the…
W75: Measurement Monopoly – Gateway by TVF
Hola folks! Genomics is a rapidly evolving field, and sequencing costs have been on a downtrend for the past two decades. And there is one company that is building the infrastructure required for this revolution. Text within this block will maintain its original spacing when published Gateway will be in…
Datadog and Google Cloud Expand Partnership to Give Developers Full Observability on Custom AI/ML Models
Datadog, the monitoring and security platform for cloud applications, is expanding its strategic partnership with Google Cloud, enabling Google Cloud customers to proactively observe and secure their cloud-native and hybrid applications within Datadog’s unified platform. As part of the expanded partnership and integrations, Datadog is one of the first…
Bayer Launches Investigator-Sponsored Collaborative Studies
By Dan Schell, Chief Editor, Clinical Leader Robert Perkins, MD, VP, Cardiovascular & Renal, Bayer Listen, if you’re going to name your clinical development program MOONRAKER — in all caps — you’re going to get noticed, especially from people like me who know that word only as the title of…
Xometry Reports Record Q3 Results, Launches Teamspace, and Partners with Google Cloud By Investing.com
Xometry Inc. has announced record financial results in its Q3 2023 earnings call, including the highest revenue and gross profit in the company’s history. The company is on track to potentially break even in Q4, following a 51% reduction in its adjusted EBITDA loss from the previous quarter. Xometry also…
DBV Technologies Announces 2-Year Results from Ongoing
Montrouge, France, November 9, 2023 DBV Technologies Announces 2-Year Results from Ongoing Phase 3 Open-Label Extension to the EPITOPE Trial (EPOPEX) of Viaskin™ Peanut in Toddlers Viaskin Peanut showed improvement between months 12 and 24 of treatment across all efficacy parameters. Notably, 81.3% of subjects who completed the oral food…
Xometry Leverages Google Cloud To Accelerate The Digitization Of Manufacturing Globally
Google Cloud Vertex AI To Help Accelerate Deployment Of Auto-Quote Methods & Models Within Xometry’s AI-Powered Instant Quoting Engine Will Help Ensure Xometry’s Instant Quoting Engine® Encompasses The Broadest Set Of Manufacturing Technologies Will Help Drive Expansion Of Markets For Custom Manufacturing Globally NORTH BETHESDA, Md., Nov. 09, 2023 (GLOBE…
Xometry Leverages Google Cloud To Accelerate The
Google Cloud Vertex AI To Help Accelerate Deployment Of Auto-Quote Methods & Models Within Xometry’s AI-Powered Instant Quoting Engine Will Help Ensure Xometry’s Instant Quoting Engine® Encompasses The Broadest Set Of Manufacturing Technologies Will Help Drive Expansion Of Markets For Custom Manufacturing Globally NORTH BETHESDA, Md., Nov. 09, 2023 (GLOBE…
Sports Nutrition: India All Set To Pip Us As Largest Developer Base On Github By 2027 | Bengaluru News
Bengaluru: Microsoft owned code-hosting platform GitHub has added 3.5 million Indian developers taking the total tally to 13.2 million in 2023. India is one of the fastest-growing developer communities globally showing a significant jump from 9.7 million developers on the Github platform last year.With 13.2 million developers, India is expected…
Datadog Expands Strategic Partnership with Google Cloud and Integrates with Vertex AI
New Vertex AI integration gives developers full observability on the prediction performance and resource utilization of their custom AI/ML models NEW YORK, Nov. 8, 2023 /PRNewswire/ — Datadog, Inc. (NASDAQ: DDOG), the monitoring and security platform for cloud applications, today announced an expanded strategic partnership with Google Cloud, which enables…
Proteintech Genomics Launches First Commercially Available Solution for the Detection of Intracellular Proteins for Single-Cell RNAseq Experiments
SAN DIEGO–(BUSINESS WIRE)– Proteintech Genomics, a subsidiary of Proteintech Group, Inc., and a provider of multiomic solutions for single-cell and spatial analysis, announced the launch of the MultiPro™ Human Fixed Cell Immune Profiling Antibody Cocktail. This cocktail contains 53 antibodies against intracellular and cell surface proteins, plus 5 isotype controls….
H2O.ai Kicks Off Inaugural Open Source GenAI World Event in San Francisco with the Winning Kaggle LLM Team and SF’s Largest Gathering of AI Grandmasters
#GenerativeAI–H2O.ai, the open source leader in Generative AI and machine learning, is responding to the overwhelming community and customer interest in bringing H2O World back to the Bay Area. This … SF’s largest gathering of Kaggle Grandmasters brings in 1000+ GenAI users to the biggest GenAI open source event Speakers…
VMware and Google Cloud Announce Planned PostgreSQL-Compatible Database Solution for Traditional and Generative AI Applications on VMware Cloud Foundation
Share “VMware and Google Cloud Announce Planned PostgreSQL-Compatible Database Solution for Traditional and Generative AI Applications on VMware Cloud Foundation” on Twitter Share “VMware and Google Cloud Announce Planned PostgreSQL-Compatible Database Solution for Traditional and Generative AI Applications on VMware Cloud Foundation” on Facebook Share “VMware and Google Cloud Announce…
vcf – VEP annotation INFO field Ensembl IDs and locations
I have a vcf file that I annoteted with VEP, for human data. I have run VEP to annotate my files with some additional parameters (as shown below in the ##VEP-command-line). However, my output is rather strange (mainly the INFO column). ##VEP=”v108″ time=”2023-04-27 15:13:08″ cache=”workflow/resources/variants/cache_vep/homo_sapiens/108_GRCh38″ ensembl-funcgen=108.56bb136 ensembl-variation=108.a885ada ensembl-io=108.58d13c1 ensembl=108.d8a9c80 1000genomes=”phase3″…
Google exhibits off what’s subsequent for Vertex AI, basis fashions
Head over to our on-demand library to view classes from VB Remodel 2023. Register Right here Leia mais AI is a core focus for Google, and at its Google Subsequent occasion right this moment the corporate introduced a sequence of updates throughout its portfolio that profit from the ability of…
Ambry Genetics Unveils at ASHG New Insights on the Use of Multiomic Testing in 43,000 Patient Study
Expanding the clinical use of RNA sequencing improves diagnostic yield, reduces inconclusive rates, and improves health equity ALISO VIEJO, Calif., November 04, 2023–(BUSINESS WIRE)–Ambry Genetics, a prominent leader in clinical genomic testing and a subsidiary of REALM IDx, Inc., unveiled at the American Society of Human Genetics (ASHG) annual meeting…
Geron Corporation Eyes $3.5 Billion Opportunity in MDS and MF Treatment Market By Investing.com
© Reuters. Geron (NASDAQ:) Corporation (NASDAQ:GERN) has updated its progress and plans during its third quarter 2023 earnings conference call, highlighting the potential of its drug imetelstat for the treatment of lower-risk myelodysplastic syndromes (MDS) and myelofibrosis (MF). The company has submitted a New Drug Application (NDA) for imetelstat, which…
GitHub Copilot is All Gain, No Pain for Microsoft
Developers love GitHub Copilot. Probably, even more than ChatGPT. It has been gaining traction ever since its launch despite several copyright claims. Satya Nadella describes it as a tool that translates and writes code in a “fairly magical way“. Reports show that it boosts developers’ productivity by 55%. Writing code…
Why Databricks is Using AMD GPUs
While the world is hell-bent on getting their hands on NVIDIA GPUs such as H100, Databricks has made a strategic move towards utilising AMD GPUs to elevate their LLM training capabilities, and it is working marvellously for the company. Last year, Databricks partnered with AMD for using its 3rd Gen…
2023-11-02 | NDAQ:AGIO | Press Release
– First Patient Dosed in Phase 3 Portion of the RISE UP Pivotal Study of Mitapivat in Sickle Cell Disease – – Completed Enrollment in Phase 3 ACTIVATE-KidsT Pediatric Study of Mitapivat in PK Deficiency; ACTIVATE-Kids Study Achieves >50% Enrollment – – On Track for Data Readouts in Two Phase…
Agios Reports Business Highlights and Third Quarter 2023
– First Patient Dosed in Phase 3 Portion of the RISE UP Pivotal Study of Mitapivat in Sickle Cell Disease – – Completed Enrollment in Phase 3 ACTIVATE-KidsT Pediatric Study of Mitapivat in PK Deficiency; ACTIVATE-Kids Study Achieves >50% Enrollment – – On Track for Data Readouts in Two Phase 3 Trials…
Open Source Definition for AI Models Need a Change
We started the year 2023 with Artificial Intelligence (AI) being one of the biggest catches, we also saw many companies going all in into this. Take for instance Mozilla, who entered 2023 with plans to work on open-source AI to develop various types of AI-powered solutions, or even HuggingChat, the…
papain family cysteine protease containing protein, maker-scaffold1702_size30647-snap-gene-0.14 (gene) Tigriopus kingsejongensis
Associated RNAi Experiments Homology BLAST of papain family cysteine protease containing protein vs. L. salmonis genes Match: EMLSAG00000006045 (supercontig:LSalAtl2s:LSalAtl2s327:400616:404607:-1 gene:EMLSAG00000006045 transcript:EMLSAT00000006045 description:”augustus_masked-LSalAtl2s327-processed-gene-4.0″) HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0Identity = 283/525 (53.90%), Postives = 368/525 (70.10%), Query Frame = 0 Query: 49 GHVARPLGKSPPNFVRDPPPRTTPPAQWLWNNVNETNFLTVSRNQHLPTYCGSCWAHAATSSLSDRIKIARQGAWPDINLAPQVLISCGPGDGCHGGEAGDANAYMHAQGITDETCSIYRARGQDNGLPCSKLEICSTCE—SKCYQPQHFFTYRVDEFHDVEGESNGEQEANMMAEIHHRGPISCGIAVTQALV-NYTGGLFHDKTGAQEIDHDISVVGYGVDEGTQEKYWLIRNSWGTYWGEQGFFRLIRGVNNLGIESGTCSWATPADTWSDAARE—RAAILSNEITLQKP——LWKQLWTVVADFVDNTRDTDLFRRLKLMQKGCKKLSSPRVPVVNIRPRPQDYVSTADLPEALDWRSVNGTNFLSWSVNQHLPVYCGSCWAQAGLSSLADRFTIADRKRFANLALSVQYILNCQAGGSCHGGDAFPLYAFIQKQGVPDVTCQPYEALDEGPLTDCSKPSKLVCKDCTWPPPEPGQEGNCWAKEKFHRYYVDEYNGVEGADNMKKEILERGPVT 560 GH+ R G+…
LianBio Announces Topline Results from Phase 3 LIBRA Trial of TP-03 in Chinese Patients with Demodex Blepharitis
LianBio SHANGHAI, China and PRINCETON, N.J., Oct. 30, 2023 (GLOBE NEWSWIRE) — LianBio (Nasdaq: LIAN), a biotechnology company dedicated to bringing innovative medicines to patients in China and other major Asian markets, today announced topline results from the Phase 3 LIBRA clinical trial evaluating TP-03 in Chinese patients with Demodex…
Meta’s AI analysis head needs open supply licensing to vary
In July, Meta’s Elementary AI Analysis (FAIR) heart launched its giant language mannequin Llama 2 comparatively overtly and totally free, a stark distinction to its largest rivals. However on the planet of open-source software program, some nonetheless see the corporate’s openness with an asterisk. Whereas Meta’s license makes Llama 2…
LianBio Announces Topline Results from Phase 3 LIBRA Trial
SHANGHAI, China and PRINCETON, N.J., Oct. 30, 2023 (GLOBE NEWSWIRE) — LianBio (Nasdaq: LIAN), a biotechnology company dedicated to bringing innovative medicines to patients in China and other major Asian markets, today announced topline results from the Phase 3 LIBRA clinical trial evaluating TP-03 in Chinese patients with Demodex blepharitis….
Smart, Google Cloud explore AI-enabled services
PLDT Group’s mobile services arm Smart Communications Inc. is collaborating with Google Cloud on utilizing artificial intelligence (AI) and generative AI solutions to improve its digital services to customers. In the photo are (from left): Ferdinand Saputil, Google Cloud Lead – Philippines; Malis Selamat, Google Cloud Country Manager – Philippines…
ViViEN: Ecosystems’ AI-Powered Value Conversations Revolutionized with Google Cloud Partnership
TL;DR: Ecosystems introduces ViViEN, a generative AI Virtual Value Engineer. ViViEN automates industry-specific value messaging and personalized value conversations. It ensures real-time monitoring and optimization of customer value. Custom-trained LLM models from Google Cloud’s Vertex AI enhance ViViEN’s capabilities. Industry leaders like Talkdesk and HP express excitement about ViViEN’s potential….
Moody’s and Google Cloud Partner on Generative AI Applications Tailored for Financial Services Professionals | BIIA.com
New tools will aim to streamline the ability of finance professionals to analyze lengthy financial reports and disclosures using Google Cloud’s generative AI Moody’s Corporation (NYSE:MCO) and Google Cloud have announced a new strategic partnership to explore bringing together Moody’s expertise in financial analysis and Google Cloud’s advanced Generative AI…
Precision BioSciences Presents Preclinical Data Highlighting Capabilities of ARCUS for Gene Insertion and Excision at the European Society of Gene & Cell Therapy (ESGCT) 30th Annual Congress
– ARCUS showed durable, high-efficiency gene insertion capabilities in NHPs and comparison to CRISPR-Cas9 – Data demonstrates ability of ARCUS to achieve large gene excisions enabling significant functional muscle improvement in a DMD mouse model DURHAM, N.C., October 26, 2023–(BUSINESS WIRE)–Precision BioSciences, Inc. (Nasdaq: DTIL), an advanced gene editing company…
LianBio Announces Presentation of Data from Phase 2a Study of Infigratinib in Patients with Gastric Cancer at ESMO Congress 2023
LianBio SHANGHAI, China and PRINCETON, N.J., Oct. 25, 2023 (GLOBE NEWSWIRE) — LianBio (Nasdaq: LIAN), a biotechnology company dedicated to bringing innovative medicines to patients in China and other major Asian markets, today announced the presentation of efficacy and safety data from a Phase 2a study evaluating infigratinib in Chinese patients…
Moody’s and Google Cloud Collaborate to Boost Financial Analysis with AI
Moody’s Corporation and Google Cloud join forces to to combine financial analysis expertise with advanced generative AI, accelerating financial insights as well as data summarisation. The partnership between Moody’s – a global integrated risk assessment firm – and Google focuses on three key objectives: Developing specialised LLMs for faster financial…
Media Briefing: Publishers air pain points at the Prebid Summit
This week’s Media Briefing looks at what was on publishers’ minds at the Prebid Summit on Monday. There are still a lot of unknowns coming down the pike for how the programmatic advertising market will function following the removal of third-party cookies from Google’s Chrome browser next year, if the…
AI’s rapid progress is driving new tools and business results
Amid the hype surrounding generative AI is one inescapable reality: Model training is moving much faster than ever before. Generative AI has put a turbo charge into the pace of model development while reducing the amount of data needed, an important trend in the future of the technology for the…
Valneva Submits Chikungunya Vaccine Marketing Application to EMA and Announces CHMP Accelerated Assessment
Saint-Herblain (France), October 25, 2023 – Valneva SE (Nasdaq: VALN; Euronext Paris: VLA), a specialty vaccine company, today announces the submission of a marketing application with the European Medicines Agency (EMA) for approval of the Company’s single-shot chikungunya vaccine candidate, VLA1553. Valneva was also granted accelerated assessment[1] for the application…
Q3 2023 Alphabet Inc Earnings Call
Participants James H. Friedland; Director of IR; Alphabet Inc. Philipp Schindler; Senior VP & Chief Business Officer; Google LLC Ruth M. Porat; President, CIO, Senior VP & CFO; Alphabet Inc. Sundar Pichai; CEO & Director; Alphabet Inc. Brian Thomas Nowak; Research Analyst; Morgan Stanley, Research Division Douglas Till Anmuth; MD;…
AMD Expands Access to AI Development with PyTorch Support
AMD, a leading manufacturer of graphics cards, is making significant strides in democratizing artificial intelligence (AI) development. The company recently announced that its Radeon RX 7900 XTX and Radeon Pro W7900 graphics cards now support PyTorch, a popular machine learning framework. This development gives developers and researchers a cost-effective and…
Moody’s partners Google Cloud on generative AI
Moody’s Corporation (NYSE:MCO) and Google Cloud today announced a new strategic partnership to explore bringing together Moody’s expertise in financial analysis and Google Cloud’s advanced generative AI (gen AI) technologies to help Moody’s customers and employees leverage new large language models (LLMs) to glean new financial insights and summarize…
Google Cloud and Moody’s boost financial operations
Google Cloud and Moody’s Corporation have announced a new strategic partnership to combine Moody’s expertise in financial analysis and Google Cloud’s advanced GenAI technologies to help Moody’s customers and employees leverage new large language models (LLMs). Powered by Google Cloud’s GenAI platform, Vertex AI, and utilizing Moody’s analytical expertise, both…
Moody’s and Google Cloud Partner on Generative AI Applications Tailored for Financial Services Professionals
New tools will aim to streamline the ability of finance professionals to analyze lengthy financial reports and disclosures using Google Cloud’s generative AI NEW YORK and SUNNYVALE, Calif., Oct. 23, 2023 /PRNewswire/ — Moody’s Corporation (NYSE:MCO) and Google Cloud today announced a new strategic partnership to explore bringing together Moody’s…
“Google has always been known as the AI company – and generative AI is really giving us the opportunity to shine” – Google Cloud VP tells us why it will be the power behind your company’s AI future
Generative AI tools have rapidly become one of the most vital tools for companies of all sizes and across all industries, but without the right support and investment from those firms driving the innovation, how useful can it really be? Given its size and influence, Google Cloud has long been at…
Unraveling Genomic Mysteries: A Conversation with Neil Ward, VP and GM of PacBio in EMEA
Neil Ward is the Vice President and General Manager for PacBio in EMEA. His role is to expand PacBio’s EMEA footprint, developing the team and its research partnerships to capitalise on the immense potential for genomics. He spoke exclusively with Healthcare Digital to discuss the latest in rare disease diagnosis…
circRNA poster to be presented at the 30th European Society for Gene and Cell Therapy (ESGCT)
Oslo, Norway, 19 October 2023 – Circio Holding ASA (OSE: CRNA) today announcesthat an abstract describing its circular RNA technology has been accepted forposter presentation at the 30th i European Society for Gene and Cell Therapy inBrussels, Belgium.The poster is scheduled for presentation 25-26 October 2023 and will beavailable on…
Exact Sciences Advances Early Cancer Detection and Precision Oncology Programs with Data Presentations at ESMO 2023 Annual Congress
MADISON, Wis., Oct. 20, 2023 /PRNewswire/ — Exact Sciences Corp. (NASDAQ: EXAS), a leading provider of cancer screening and diagnostic tests, today announced it will present new data supporting the company’s research in early cancer detection, genomic testing, and treatment guidance at the 2023 European Society for Medical Oncology (ESMO)…
Circio: circRNA poster to be presented at the 30th European Society for Gene and Cell Therapy (ESGCT) -October 19, 2023 at 01:05 am EDT
Oslo, Norway, 19 October 2023 – Circio Holding ASA (OSE: CRNA) today announces that an abstract describing its circular RNA technology has been accepted for poster presentation at the 30th iEuropean Society for Gene and Cell Therapy in Brussels, Belgium. The poster is scheduled for presentation 25-26 October 2023 and…
Onix Unveils New Data and AI Solutions Post Datametica Acquisition
Accelerated migration and transformation to Google Cloud for customers to deploy enterprise-grade AI New York, New York–(Newsfile Corp. – October 19, 2023) – Onix, a renowned and award-winning Google Cloud partner, has recently expanded its data and AI capabilities by acquiring Datametica. This strategic move aims to establish a company…
Element Biosciences to Present at ASHG 2023
Element will share details on its novel sequencing methodology and host a workshop on higher accuracy sequencing for improved variant detection SAN DIEGO, Oct. 19, 2023 /PRNewswire/ — Element Biosciences, Inc., developer of the Element AVITI™ System, an innovative DNA sequencing platform that is disrupting the genomics industry, will present new…