Tag: VP

Local Doctors Compare Vaccine Types and COVID-19 Strategies While China Struggles to Limit Omicron Rise

MADISON (WKOW) The Wisconsin Department of Health Services said the BA2 Omicron sub-variant is now responsible for the majority of new COVID-19 cases in the United States. The number of cases is slowly increasing, but we have not seen a major increase in the US since January. China’s largest city,…

Continue Reading Local Doctors Compare Vaccine Types and COVID-19 Strategies While China Struggles to Limit Omicron Rise

Hydrogen Torch Panel with H2O.ai Kaggle Grandmasters

  H2O Hydrogen Torch is democratizing AI by simplifying and streamlining the process of making state-of-the-art deep learning models for all data scientists, from the novice to the expert. Deep learning can learn and make intelligent decisions on its own, even with limited and unstructured data available. H2O Hydrogen Torch unlocks…

Continue Reading Hydrogen Torch Panel with H2O.ai Kaggle Grandmasters

Fortis Life Sciences Inks Distribution Deal for AccuGenomics NGS Standards Tech

NEW YORK — Fortis Life Sciences, a provider of capital and other resources to life science tool companies, said on Tuesday that it has signed a deal to distribute AccuGenomics’ SNAQ-SEQ internal standards technology for next-generation sequencing in the US and Europe. Under the terms of the deal, Waltham, Massachusetts-based…

Continue Reading Fortis Life Sciences Inks Distribution Deal for AccuGenomics NGS Standards Tech

Annotations: 6Q5U

B Phage_Capsid_P3_2nd e6q5uB1 A: beta sandwiches X: jelly-roll H: Nucleoplasmin-like/VP (viral coat and capsid proteins) (From Topology) T: Nucleoplasmin-like/VP (viral coat and capsid proteins) F: Phage_Capsid_P3_2nd ECOD (1.6) B Phage_Capsid_P3_1st e6q5uB2 A: beta sandwiches X: jelly-roll H: Nucleoplasmin-like/VP (viral coat and capsid proteins) (From Topology) T: Nucleoplasmin-like/VP (viral coat and…

Continue Reading Annotations: 6Q5U

Nuprobe USA Inc. Quality Assurance Manager

Quality Assurance Manager- Molecular NGS, PCR, IVD Quality Assurance ManagerHouston TX NuProbe USA Inc. is looking for a Quality Assurance Manager to lead the Quality program to establish and maintain compliance to ISO: 9001, ISO: 13485, and FDA 21 CFR Part 820 Quality System Regulations. NuProbe USA is a rapidly…

Continue Reading Nuprobe USA Inc. Quality Assurance Manager

Job Application for Director, Bioinformatics Applications at Recursion

Recursion is a clinical-stage biotechnology company decoding biology by integrating technological innovations across biology, chemistry, automation, data science and engineering to radically improve the lives of patients and industrialize drug discovery. Our team is working to solve some of the hardest, most meaningful problems facing human health today. Come join…

Continue Reading Job Application for Director, Bioinformatics Applications at Recursion

Prometheus Biosciences Provides Corporate Updates at the 40th Annual J.P. Morgan Healthcare … | News

– Fast Track Designation granted from U.S. Food and Drug Administration for PRA023 for the treatment of Systemic Sclerosis-Associated Interstitial Lung Disease (SSc-ILD) – – New patent granted for PRA023 companion diagnostic (CDx) reinforces Prometheus’ precision approach and extends CDx patent coverage into 2040 – – Company to present today…

Continue Reading Prometheus Biosciences Provides Corporate Updates at the 40th Annual J.P. Morgan Healthcare … | News

Characterization of Blood- Based Molecular Profiling in Pancreatic Adenocarcinoma

Introduction Most cases of pancreatic adenocarcinoma (PDAC) are diagnosed in the metastatic or locally advanced stage. It is the fourth leading cause of cancer death in the United States,1,2 with a 5-year overall survival (OS) around 10% in this country2 despite years of research and therapeutic development. For those patients…

Continue Reading Characterization of Blood- Based Molecular Profiling in Pancreatic Adenocarcinoma

ddPCR allows 16S rRNA gene amplicon sequencing of very small DNA amounts from low-biomass samples | BMC Microbiology

1. Lane DJ, Pace B, Olsen GJ, Stahl DA, Sogin ML, Pace NR. Rapid determination of 16S ribosomal RNA sequences for phylogenetic analyses. Proc Natl Acad Sci U S A. 1985;82(20):6955–9. PubMed  PubMed Central  CAS  Google Scholar  2. Vos M, Quince C, Pijl AS, de Hollander M, Kowalchuk GA. A…

Continue Reading ddPCR allows 16S rRNA gene amplicon sequencing of very small DNA amounts from low-biomass samples | BMC Microbiology

10q26 FGFR2 Break Apart FISH Probe Kit

1 0q26 FGFR2 Break Apart FISH Probe Kit For Research Use Only Not for Use in Diagnostic Procedures 0q26 FGFR2 Break Apart FISH Probe Kit 09N /R2 Key to Symbols Used 09N /R2 Reference Number Lot Number Global Trade Item Number Centromere D0S294 0q26. Region FGFR2 5 ATE SHGC-529 Telomere…

Continue Reading 10q26 FGFR2 Break Apart FISH Probe Kit

r – ggplot2 Set geom_point Size according to a Factor

I am trying to set the size of geom_point according to a factor. I know it is not advised, but my data is extremely unbalanced (the minimum value is 6 while the maximum is larger than 10,000). I am trying to make the size of the points reflect the total…

Continue Reading r – ggplot2 Set geom_point Size according to a Factor

Director of Bioinformatics Research Job Opening in Hudson, FL at M2GEN

Director of Bioinformatics Research Location:  Remote Status:  Full-time ExemptReports to:  VP Bioinformatics & BiostatisticsDirect Reports:  Build and lead a team consisting of bioinformatics research scientists that support internal business development client engagements, as well as, external academic partner research projects and biopharma sponsored bioinformatics services Who we are M2GEN is…

Continue Reading Director of Bioinformatics Research Job Opening in Hudson, FL at M2GEN

Epistasis shapes the fitness landscape of an allosteric specificity switch

Computational design Protein modeling and design was performed with Rosetta version 3.5 (2015.19.57819)35,37. Python and shell scripts for generating input from Rosetta and analyzing from Rosetta are available at: github.com/raman-lab/biosensor_design The high-resolution TtgR structure co-crystalized with tetracycline was selected as the starting point for computational design (PDB: 2UXH)28. The structure…

Continue Reading Epistasis shapes the fitness landscape of an allosteric specificity switch

hypothetical protein DAPPUDRAFT_213302, maker-scaffold2255_size18018-snap-gene-0.6 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of hypothetical protein DAPPUDRAFT_213302 vs. L. salmonis genes Match: EMLSAG00000000401 (supercontig:LSalAtl2s:LSalAtl2s1063:86108:87342:-1 gene:EMLSAG00000000401 transcript:EMLSAT00000000401 description:”maker-LSalAtl2s1063-snap-gene-0.46″) HSP 1 Score: 149.443 bits (376), Expect = 4.121e-44Identity = 91/196 (46.43%), Postives = 119/196 (60.71%), Query Frame = 0 Query: 14 MDKITDLQVEPLT–NSRFVKPLRLRFKQDGKVKVWDLIQCHASVAVVIFNQTTQKFVFVRQFRPAVYFSALRRAQGDVEPGTQFKGDEIDPKVGITLELCAGIVD-KSKSLIEIAHEEILEETGYDVPMNLIEEIQTFPVGVGVGGENMTLFCAEVTEAMRKGPGGGLAEEGEMIDVIEMGVEETRTLMRAKSVT 206 MDK+ VEPL +SRFV P R+ ++Q+G…

Continue Reading hypothetical protein DAPPUDRAFT_213302, maker-scaffold2255_size18018-snap-gene-0.6 (gene) Tigriopus kingsejongensis

Illumina Ventures sets sights on European genomics startups with new $325M fund

Illumina Ventures, the independently managed venture capital firm bankrolled by the DNA sequencing giant, has closed its second investment fund, amassing $325 million in new commitments. ​The proceeds will be used to support genomics-focused, early-stage startups looking to build new clinical diagnostics and life science research tools as well as targeted…

Continue Reading Illumina Ventures sets sights on European genomics startups with new $325M fund

Affinia Therapeutics hiring Senior Scientist, Bioinformatics/Computational Biology in Waltham, MA, US

About Affinia Therapeutics Affinia Therapeutics is working to transform gene therapy through a methodically designed proprietary platform. By engineering vectors and gene constructs, Affinia is building toward revolutionary treatments for devastating diseases. Job Description Scientist/Senior Scientist, Bioinformatics/Computational Biology Affinia Therapeutics is an innovative gene therapy company with a proprietary platform…

Continue Reading Affinia Therapeutics hiring Senior Scientist, Bioinformatics/Computational Biology in Waltham, MA, US

InterVenn Biosciences – VP of Bioinformatics

At InterVenn, we believe no one should ever be blindsided by disease. Our technology enables and empowers the understanding of Glycoproteomics, a new layer of biology beyond the genome, using a simple blood draw. InterVenn’s powerful solutions will broaden humankind’s perception and interpretation of diseases like cancer. We look forward…

Continue Reading InterVenn Biosciences – VP of Bioinformatics

The 13 health care leaders on the list

Time this week released its “100 Most Influential People” list, which includes a number of individuals who have made major contributions to health care. The 10 ‘most influential’ health care companies, according to TIME The list This year, TIME recognized several health care providers, scientists, public health officials, and advocates for their…

Continue Reading The 13 health care leaders on the list

The Current Molecular Treatment Landscape of Advanced Colorectal Cancer and Need for the COLOMATE Platform

Next-Generation Sequencing Utilizing Tumor Tissue and/or Blood The identification of actionable genomic alterations in tumors such as mCRC was once performed by Sanger DNA sequencing of tumor DNA that was extracted from fixed paraffin-embedded tumor tissue, but this has now been replaced by next-generation sequencing (NGS), which allows for larger-scale…

Continue Reading The Current Molecular Treatment Landscape of Advanced Colorectal Cancer and Need for the COLOMATE Platform

VP of Bioinformatics Job Opening in South San Francisco, CA at InterVenn Biosciences

EMAIL* UPLOAD YOUR RESUME By clicking Agree, I consent to our data usage policies as stated here By agreeing to submit your resume, you consent (in accordance with our Terms of Use and Privacy Policy) to: A) Salary.com storing your resume for purposes of providing you with the job posting…

Continue Reading VP of Bioinformatics Job Opening in South San Francisco, CA at InterVenn Biosciences

Top Limitations of SAM Tools Guide

There is a common misconception that Software Asset Management (SAM) tools can completely mitigate your risk of a costly and disruptive audit. In fact, studies show zero correlation between having a SAM tool in place and whether you will end up paying audit fees or how much you will ultimately…

Continue Reading Top Limitations of SAM Tools Guide

probable dimethyladenosine transferase-like, maker-scaffold153_size302544-snap-gene-2.18 (gene) Tigriopus kingsejongensis

Associated RNAi Experiments Homology BLAST of probable dimethyladenosine transferase-like vs. L. salmonis genes Match: EMLSAG00000006273 (supercontig:LSalAtl2s:LSalAtl2s341:673186:674124:1 gene:EMLSAG00000006273 transcript:EMLSAT00000006273 description:”augustus_masked-LSalAtl2s341-processed-gene-6.3″) HSP 1 Score: 484.567 bits (1246), Expect = 2.083e-174Identity = 227/310 (73.23%), Postives = 259/310 (83.55%), Query Frame = 0 Query: 9 KVRKTGSGMSTVEAAGSGGGGQQGMVFNTGLGQHILKNPLVVQSIIDKAALRSTDVVLEIGPGTGNLTVRALEKCKKLIACEVDPRMVAELQKRVQGTHFQSKLQIMVGDVIKTDLPFFDACVANVPYQISSPLVFKLLLHRPFFRCAVLMFQREFAQRLVAKPGDKLYCRLSINTQLLARVDHVMKVGKGNFRPPPKVESSVVRIEPRNPPPPINFKEWDGLTRVAFVRKNKTLGAAFNQTTVLMMLEKNYRVHLSLADEPVPEKIDIKSIIETVLAEIAFKEKRARSMDIDDFMKLLHAFNAKGIHFV 318 KV+ T + GG+QG+VFNT LGQHILKNP VV…

Continue Reading probable dimethyladenosine transferase-like, maker-scaffold153_size302544-snap-gene-2.18 (gene) Tigriopus kingsejongensis

SCIRP Open Access


Continue Reading SCIRP Open Access

ABRF Study Benchmarks NGS Platforms on Human, Microbial Samples, Provides Peek at Genapsys Data

NEW YORK – The results of a major, core facilities-driven benchmarking study for next-generation sequencing platforms are in, and just about every major player in the field can claim a victory of some sort. The data support longstanding advantages touted by market leader Illumina, while also providing a sneak peak…

Continue Reading ABRF Study Benchmarks NGS Platforms on Human, Microbial Samples, Provides Peek at Genapsys Data

dna sequencing flow chart – Boran

Flow Chart Showing Steps For Dna Sequence Analysis Esp . Flowchart Of Bisulfite Dna Sequencing Analysis Download . The Following Flow Chart Depicts The Struture Of Dna . Flowchart Describing Assembly And Annotation Procedures The . Flowchart Of Biobarcode Dna Sequence Identification And . Figure 2 From A Labor And…

Continue Reading dna sequencing flow chart – Boran

Change chromosome notation in dbSNP VCF file

Change chromosome notation in dbSNP VCF file 0 Hiii, I have downloaded dbSNP VCf file from [ftp.ncbi.nih.gov/snp/organisms/human_9606/VCF/] The format is as follows: #CHROM POS ID REF ALT QUAL FILTER INFO 1 10019 rs775809821 TA T . . RS=775809821;RSPOS=10020;dbSNPBuildID=144;SSR=0;SAO=0;VP=0x050000020005000002000200;GENEINFO=DDX11L1:100287102;WGT=1;VC=DIV;R5;ASP 1 10039 rs978760828 A C . . RS=978760828;RSPOS=10039;dbSNPBuildID=150;SSR=0;SAO=0;VP=0x050000020005000002000100;GENEINFO=DDX11L1:100287102;WGT=1;VC=SNV;R5;ASP 1 10043 rs1008829651 T…

Continue Reading Change chromosome notation in dbSNP VCF file

blastx versus tblastx

hello everyone I have a question about the blast. I admit that I do not understand everything. I have been asked to blastx an fsa file of arabidopsis thaliana sequences against an oak gene model. In order to see if there were any matching sequences between the two species: My…

Continue Reading blastx versus tblastx